SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021714 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021714
Domain Number 1 Region: 47-787
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-252
Family Motor proteins 0.000000000331
Further Details:      
 
Domain Number 2 Region: 2046-2134
Classification Level Classification E-value
Superfamily PH domain-like 4.67e-17
Family Third domain of FERM 0.028
Further Details:      
 
Domain Number 3 Region: 1930-2045
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-17
Family Second domain of FERM 0.0072
Further Details:      
 
Domain Number 4 Region: 1228-1331
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000322
Family First domain of FERM 0.027
Further Details:      
 
Domain Number 5 Region: 1829-1936
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000672
Family Ubiquitin-related 0.067
Further Details:      
 
Domain Number 6 Region: 1323-1416
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000000753
Family Second domain of FERM 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021714
Domain Number - Region: 797-862
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000125
Family Motor proteins 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021714   Gene: ENSGACG00000016439   Transcript: ENSGACT00000021755
Sequence length 2149
Comment pep:known_by_projection group:BROADS1:groupIII:10426565:10442892:1 gene:ENSGACG00000016439 transcript:ENSGACT00000021755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVMLRKGEWVWVDSDIGVPIGAKVKVTKSGRRLLVDDDGKEKSLSQEQEASLKIMHPTSV
EGVDDMIKLGDMNEAGLLRNLLLRHKRDIIYTYTGSVLVAVNPYQAYPLYSVDQVQMYHG
RQLGELPPHIYAIAESAYGNMTRNLRNQCCIISGESGAGKTESTKLILQYLAAVSGELSH
QQIEEQILQSNPILEAFGNAKTIRNDNSSRFGKYLEIFFNKDGVIEGARVEQYLLEKSRV
CHQAPHERNYHMFYCMLAGVTAEEKKTLSLGDAKEYTFLSKGDTVDCEGRDDAKDYKIIC
SAMKVLTFSESQCQEILKLLAAILHLGNICFEANTQNNLETSEVSKSQHFSIAASILEVR
KSSLASSLTHRSFMTNRERVTKPLSAEQASDSRDAFVKAIYNKLFVWIVGKINNVIYKKL
ANNPKSSFLSIGLLDIFGFENFKTNSFQQSVARLAAKKKTDVVLRHIFKLEQKEYRKEDI
VWNKIRFSDNQNILDVLAVKPCNLLALIDEESHFPKGSDLTMLNKMNQQHSGNKTYIASK
SEHHTDFGIRHFAGVVHYDSKGFLEKNRDAVSFDIIKMVDLTTNKLLHQIFETELSTNAQ
SDSRKQVTTLSAQFRQSLDSLMKALSACQPFFIRCFKPNNEKQSKVFDRELCMRQLRYSG
MMDTIRIRKLGYPIRHTFVEFLHRYRVLLKTTVCDPKTETAAACCEAICQTAIEGADEWK
IGRTKIFLRDAHDAVLERLREQRLGKIALVIQRVMLGHKDRKSFLKKRRAAVVLQKNWRA
YKQEKILLNQIQKGFERLVSKIRSRKLRLQHLRQREAALTIQSQVRGYRERKGWKQKREA
VILLQACSRGLLARRIAEKKRKDLLFTQTPSQASLLLLAKENQQKIASELQQRLAAIARL
QPAHQEPEPIVERDSEDDASDLQPTPPVEVIKPESPPSNGFQKRNVPTPVEETSVETSEQ
KIVTAASSTPTPSVEEEEEDDEFDEGSDEFSFNAFSSLHFQGNADHTHFNQRLRQPLLHH
DDEGDALACLTIWWIILRYMGDMPEPRPVDATSQSSTIASRQLPQRQGRRLSSLVGLDQK
IMRKNKKKLGGGSRKASMIPEEPENFTEEDNILIGEGPTLDRPLSSLEKLQFIIGYALSR
PNIRDEIYCQICKQLVNNKNRRSRMQGWILLSICLGIFPPSEVFMKYLERFVRRGPDGYG
KYCAERLTRTAANSARKELPCWTEEQAAKSKKPIDVAVTIEDDRAIRLQVDSASTSAEVC
QAVADQIGLRDTYGFSLYISFNEKMWSLGSSGRHVFDAVSQCEQEMRRQGKKEKDAPWRL
SIRKELFTPWHDTSVDPISTDLIYRQVIKGIKMGEYTSDNDNDYVHLGAQNYYIQFGSAC
NKDNVGKVVEECISTTLLEKKSKTKWIELINTAHMEGPYINGNQTSDSVKGELVSNAQHA
WPLHFSKFFEATLISGPSLLKSRFFVAVNSSGVFFMDGRDKSLLQIPYLEVKDVRIINDS
HFSDTGSLSLATVKGEFVLTSADAVEMAALIEKNLDGLRRRSVYALAQQDVGKPASADDP
AFLLCKRGDLLLVKDRSGFPDNNVMKVTNQRTGAECAVHKDTVQFLPTLEKPTDVMLELL
CPGQRKQSTAQNNNLRNDTVAPISLKEFAFDYFRPAAKDAGRHGAGKVVVRERLWACSRE
PLKQPLLKSLLGNSDLSNLACSIFTDILGTNASEYMGDYPIKHARSPLELTDQIFGPATQ
HEALQDEVYCQIMRQMTNNPSRLSMERGWQLMWLCLGLFRPSPNLQKHTQHFLESRPRDQ
LAPGCLKRLHQMSRKEPRKLPPHPVEVDAIQQNSTQIFHKIHFPNDTSDIFEVKSTSTIE
TLCRSIAIKLKVSSAEGYGLYLKTPNKLVSMEEQNYFFDSLRQTSEAPKKAKKVKEGNPA
MAPYRVIFKRKLWFNVSPGKDLVADLTFHFPQELPRYLRGYHNCTKEDMTNLGGLLFRVE
VDSDRSQFVMIPRMLRELVPADQLKIMSPEEWKKHIVSAYNRQSGITVQEAKIAFLKDIS
SWPTFGCSFFEVKQTCDSSYPNTVLISISKQGVCLIDPVTKELLVMHPFSRITEYQSDSG
YFEMTIGTMGNIFVCETTQAHTMEDLLRSYITMYERQRQNFRPRNQMFS
Download sequence
Identical sequences G3PVS5
ENSGACP00000021714 ENSGACP00000021714 69293.ENSGACP00000021714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]