SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021731 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021731
Domain Number 1 Region: 624-692,923-1261
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-119
Family Ras GEF 0.0000164
Further Details:      
 
Domain Number 2 Region: 227-449
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-44
Family DBL homology domain (DH-domain) 0.00023
Further Details:      
 
Domain Number 3 Region: 22-138
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-16
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 4 Region: 437-593
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000911
Family Pleckstrin-homology domain (PH domain) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021731   Gene: ENSGACG00000016457   Transcript: ENSGACT00000021772
Sequence length 1263
Comment pep:known_by_projection group:BROADS1:groupII:15355232:15376425:-1 gene:ENSGACG00000016457 transcript:ENSGACT00000021772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGMRLNDGHITYLALLAKKDGTRRGCLSKKSSDNTKWHSKWFALLQNMLFYFENDSSS
RSSGLYLLEGCVCDRAPSLKPSSLSGVSAELQEYYFTVTFNHDNQKALELRTEDVKDSDE
WVAAITQASYRNLATEHETLMQKYLHLLQIVETEKMVAKQLRQQIEDGEIEVERLKSEVT
RLISGLLKDNEKIQSNPEVPPSEDDTEIKKIKKVQSFLRGWICRRKWKTIIQDYIRSPHA
ESMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSET
IMFLHQIFYQGLKARIASWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRD
FDKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERTSLDYAKSK
LEELSRIMHDEVSETENIRKNLAIERMIVEGCEVLLDTSQTFVRQGSLIQVPMSEKGKIT
RGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHITKNGVVSLIDCTLMEEPEGTDDE
SRVERSGQDVEHLDFKVMVEPKDVQPYTIILVASSRQEKAAWTSDISQCIDNIRCNGLMM
NAFEENSKVTVPQMIKSDTSLYCDDVDIRFSKMMNSCKVLQIRYASVERLLERLTDLRFL
SIDFLNTFLHSYRVFTSADVVLDKLITIYKKPISAIPARSLELFFASSQNNKLLYGEPPT
SPRVSRKFSSPPPLSITKSSSPNRRRKLSLNIPIITGGKALDLAALSCSPNGYTSVHSTI
SPFSKTTLDINKLYVAGNVAGKIPDEGETKAEGKAEESVPNKQEASVREECDQEPRQSEE
AEAEMSPPKSPSTPKNVKSKNSAEFSLFSFNVGMVVSSCRELDSNRSALSAASAFAIATA
GANEGTPTKEKYRRMSLASAGFPTDQRNGDKEFVIRRAATNRVLNVLRHWVSKHSQDFEL
NTEMKMRVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQVTLEEIIQMASEDCK
TEPFESHSALEIAEQLTLLDHLVFKVIPYEEFFGQGWMKNDKNERTPYIMKTTKHFNDVS
NKIATEILQWDDVNLRVGVIEKWVAVADICRCLHNYNAMLEITSSLNRSSIFRLKKTWLK
VSKQTKTVIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFIEEGTPNYTED
NLVNFSKMRMISHIIREIRQFQQTAYKIDYQPKVAKYLLDSSTALDEESLYDASLRIEPK
TSS
Download sequence
Identical sequences G3PVU2
ENSGACP00000021731 ENSGACP00000021731 69293.ENSGACP00000021731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]