SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021744 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021744
Domain Number 1 Region: 604-971
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.29e-126
Family Hect, E3 ligase catalytic domain 0.00000000414
Further Details:      
 
Domain Number 2 Region: 20-166
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.05e-31
Family Synaptotagmin-like (S variant) 0.042
Further Details:      
 
Domain Number 3 Region: 548-586
Classification Level Classification E-value
Superfamily WW domain 0.000000000000025
Family WW domain 0.0003
Further Details:      
 
Domain Number 4 Region: 383-421
Classification Level Classification E-value
Superfamily WW domain 0.000000000000459
Family WW domain 0.0015
Further Details:      
 
Domain Number 5 Region: 500-535
Classification Level Classification E-value
Superfamily WW domain 0.00000000000278
Family WW domain 0.0011
Further Details:      
 
Domain Number 6 Region: 184-221
Classification Level Classification E-value
Superfamily WW domain 0.000000000264
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021744   Gene: ENSGACG00000016463   Transcript: ENSGACT00000021785
Sequence length 978
Comment pep:known_by_projection group:BROADS1:groupXIV:3954611:3985995:-1 gene:ENSGACG00000016463 transcript:ENSGACT00000021785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAANYEPIYGLSEDEHETRVLRVKVIAGMDLAKKDIIGASDPYVKLSLYVAEENKELGLV
QTKTIKKTLNPKWNEEFFFRVCPQNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPA
MERPYTFKDFLLRPRSHKSRVKGYLRLKMAYLPKQGGPEEEAGEMREEAEDYGWDESADS
GSQRPQQLLPPLPPGWEEKVDNLGRTYYVNHNKRTQWKRPSNIDVISETESDNQQRQINQ
EAHRVFRSRRHISEDLENEHMEPRDLDNSWELITEEDPNESLAQSQPGTSSVSTPQPAPT
SVERDISEDLSLRLSIAPDTNGEVPGPSAALSQLSSRLRSSSMTDGVSDQTQAPPLMGSQ
TRRTRAQTVSGGEESMSPSATAYALTTPGLPPGWEERKDGKGRTYYVNHNSRTTTWTRPI
VQLTEDGASTSAAEPNNHLHEPQVRRPRSLSSPTVTLSTPLEGANNIQARRAVKDTFSNP
QSPQPSPYSSPKSQPKTQQSFLPPGWEMRIAPNGRPFFIDHNSRVTTWEDPRLKYPVHMR
TKNSIEPGELGPLPPGWEERIHSDGRTFYIDHNTKNTQWEDPRLQSPAITGPAVPYSREF
KQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEESYRRIMSLKRPDVLKARLWIEFESEKG
LDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVA
GMAVFHGKLLDGFFIRPFYKMMLGKQISLKDMESVDSEYYNSLKWILENDPTELDLRFCI
DEDNFGQTYQVDLKPSGSDMVVTNENKKEYIDLVIQWRFVNRVQKQMNAFLEGFTELILI
DLIKIFDENELELLMCGLGDVDVNDWRQHTVYKNGYCPNHPVIQWFWKVVLLMDAEKRIR
LLQFVTGTSRVPMNGFAELYGSNGPQLFTIEQWGTPEKLPRAHTCFNRLDLPTYDSFEDL
REKLLMAVENAQGFEGVD
Download sequence
Identical sequences G3PVV5
ENSGACP00000021744 69293.ENSGACP00000021744 ENSGACP00000021744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]