SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021747 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021747
Domain Number 1 Region: 124-506
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.01e-141
Family Myotubularin-like phosphatases 0.0000000271
Further Details:      
 
Domain Number 2 Region: 22-112
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000479
Family GRAM domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021747   Gene: ENSGACG00000016465   Transcript: ENSGACT00000021788
Sequence length 576
Comment pep:known_by_projection group:BROADS1:groupIX:4204946:4218828:1 gene:ENSGACG00000016465 transcript:ENSGACT00000021788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTPKVENARLLDRSSGQRKASIGTLYLSATHTIFVENNPETRKETWVLHSMLSSVE
RPPTIPAGSQLILHCKDFRVFQILIPQERDCLEVHTSLLRLSRPEKYSELYCLSFNPNVN
KVEREESWNFIDLTADFKRMGVPNNLWVATVANSEYRVCDTYPSQLFVPKSATTALIVGS
SRFRSRGRFPVLSYFHQDTLAAVCRCSQPLSGFSGRSQDDEMMLQVMMKSNPGSDYIYVV
DTRPKLNAMANRAAGKGYENEDHYTNIKLQFIGIENIHVMRSSQQKILDVGEMRSPSMTD
FLYGLENSGWLKHIKAVLDAGLFIAKAVANEGVSVLVHCSDGWDRTAQACSVASILLDPY
YRTIKGLMVLIERDWVSFGHKFSQRYAHLDGDPKEVSPVIDQFLECVWQLSEQFPCAFEF
NERFLIAIHTHIYSCQYGSFLGNSEKERRDMRLHERSHSLWPELWKDRAEYTNPLYKDEL
SQSQGVLRPNTTPYCFKMWKGLYNRMEKSIPPCQSAAHFLSAVKGESQQLKEELTNHQEV
PSEGTANHKPLGFRQDNNPNREADLMGGNECPDEED
Download sequence
Identical sequences G3PVV8
ENSGACP00000021747 69293.ENSGACP00000021747 ENSGACP00000021747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]