SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021815 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021815
Domain Number 1 Region: 143-324
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-58
Family Phosphotyrosine-binding domain (PTB) 0.000000107
Further Details:      
 
Domain Number 2 Region: 513-573
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-17
Family SH2 domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021815   Gene: ENSGACG00000016518   Transcript: ENSGACT00000021856
Sequence length 580
Comment pep:known_by_projection group:BROADS1:groupXIV:4203228:4211157:-1 gene:ENSGACG00000016518 transcript:ENSGACT00000021856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLHRTKYNRFRNESVTSVDELLHGLSMNPKVSATPQSAAETSYTPPTEVQPSAAAACSIS
TGHGSDHLEDGGTTLCTLINKVSGLKFSNSGSLLGIKGLPSAVKDLAASKLQGGGGLGSG
GGGGGGGGVPAAATSGDWNPGGGGGGLVIKPSRGWLHSSEKISGPGVTYVVKYLGCIEVL
CSMRSLDFTTRSQITREAISLVCEAVPGTKGALRKRKPPSKALSSILGKSNLQFAGMSIN
LNISTSSLNLMTPDCKQIIANHHMQSISFASGGDPDTTDFVAYVAKDPVNRRACHILECS
DGLAQDVIRTIGQAFDLRFQQYLQCPSGKLSSTHDRVLNMEELPWTEEEEESAEHPYYNN
IPGKMPPPGGFIDTRLTTQNAAADGCGVQLLDQTYYQGRHCGENWGDERKVIFIQQGSFD
ISGLPESKGQAPKTGEMPAYVNTQQIDAQVLAALQAEAEHCPQKDLFDMKPFEDAIQSQS
HPPSQPQVAAIHKTASVDNCSPLLARSVAFRAQEELQGQMWYHGQMSRRDAEKLLKEDGD
FLVRTSTTNPGSDVLTGMHNGLAKHLLLVDPEGTVRARRA
Download sequence
Identical sequences G3PW26
69293.ENSGACP00000021815 ENSGACP00000021815 ENSGACP00000021815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]