SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021830 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021830
Domain Number 1 Region: 1217-1350
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.63e-32
Family Synaptotagmin-like (S variant) 0.057
Further Details:      
 
Domain Number 2 Region: 2032-2166
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.32e-19
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 3 Region: 1084-1142
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000449
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021830
Domain Number - Region: 242-319
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00942
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021830   Gene: ENSGACG00000016527   Transcript: ENSGACT00000021871
Sequence length 2207
Comment pep:known_by_projection group:BROADS1:groupII:15803295:15876013:1 gene:ENSGACG00000016527 transcript:ENSGACT00000021871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSALINTISSYIKKICKGMFTKKLANPIKKKERSENKEPKLTYDLQAHHPALSTTLKTT
VKKISKCSSARNISLEDDDGKYDCSSLSPTFSYRVAIANGLPKNSLFLNNNESIFPGVLS
IDASYSDSLSEPKLVRRFDEHKSHTMPVRRNRKSLISLAPSDGSSEGERVERSSLHTLRL
GALRKLRKWKKSQECVSSDSEVSNWRKTLGLRSKSLDRAGRQQKSSTLEPGSSSTGCISQ
TQDVMEMIFKELQGISQIETELSELRGHVNALKSSIDEISSSVEVVQSEIEQLRTGFVQS
RRETRDIHDYIKQISHQANNSTLRFINVPEERSEKTECLIYKILKDKMGFIDAHKTIKIE
LAHRLGQQRECSNSKPRPIIVIFATTQERDIVLKKCYKLKGTGITVSTDSLTPDGKERKD
KTMSSSQTYESMDIKVSGKDKVVESDDWDSMDSDKELDELSRNKYAMVISKPTHKSKSEK
RRSHDHSRSGEEAGYSGAVRYADDSYYDPDKQAKAYYSDLTTGWLSQSDYSTPKLSRSES
DCSKLCQSYSEDFSESQYFTRANGCPLLSSSDQELWQRKQEDMASSWYASDSHQLSRTYE
HNEVETTETVDSGVSNGLVGISGDRSHYSGSQLSLQGDLSPWKDWHHLEQGADSGLEASI
EVSTTVSSKVTSKAALKESPKEIQKSAAKESFQSLPKDSPKVTPKDATKPGVKETPKVIP
KDKFPELDINHSFHQNQSKSTTMYRSQSEIRTEKVEEVPKSWSSRLSIDLSEKSFGFGFG
STLQRAKSALEVVWKSGPQTPTAAPPEETTNSSFMGRFRTLSTSGVNTSSGTTDFDAEPV
FNRAEEDKARAEAEAGEQQVDDETHYVEVMEQVLANLENRSNTNETDEEYKDTAEYDAMV
EYVDVEEPDDNDVTEEMEDGDEELEDIEEIIEEDNEGSEKVEREDENKNVPEEKPTEAPP
KKHVRPTFKEAALRAYRKQMAELEQQILAGVSISVSQKKNVKSCNAIDQSPFHCFCIFQA
GSILYGIDSMPDLRRKRTVPLVRDLKMTLTARKAGISFALVNRSTLNNEDLKLHVFKKTL
QALIYPISSTTPHNFEVWTATAPTYCHECEGLLWGIARQGMRCSECGVKCHEKCQDLLNA
DCLQRAVEKNSKHGAEDKTQNIIMAMKERMKIREKNTPEVFEVIQEMFHVSKEDFTSHLK
TAKQAVLDGTSKWSAKITITVMSAQGLQAKDKTGSSDPYVTVQVGKTKRRTKTIFGNLNP
VWDEKFFFECHNATDRIKVRVWDEDDDIKSRVKQHFKRESDDFLGQTIIEVRTLSGEMDV
WYNLDKRTDKSAVSGAIRLKISVEMKGEENVVPPHGQYTCLHENLFHCLTEVKNGGVVKI
PKVKGDEAWKVYFDDVSQEIVDEFAMRYGVESIYQAMTHFSCLSAKYMCPGVPAVMSNLL
ANINSYFAHTTTTTTTTASASDRFAASNFGREKFVKLLDQLHNSLRIDLSKYRDNFPAGN
PERLQDLKSTVDLLTSITFFRMKVVQELQSPPRASMVVKDCVKACLDSTYKYIFDNCHEL
YNQLLDQSRKQDIPREEQGPSIKNLDFWPKLITLMVSVIDEDRTAYTPVINQFPQELNAG
KISAEIMWSLFALDMKYAMEEHDKHRLCKSTEYMNLHFKVKWFHNEYVRDLPAFKNVPPE
YSLWFEPFVIQWLDENEEAAMDFLNGALERDKKDGFQQTSEHALFSCSVVDVFTQLNQSF
EIIKKLECPNPQALAHFMCRFAKTINKVLLQYAVIISKDFPLYLSKENVPCIILNNIQQL
RVQLEKMFESMGGKQLDAEASDLLKELQNKLNTVLDELSGVFGSSFKGVIEDCVKQMNQE
LVQMKGTAKGSNAAMDAETVLRPLMDLLDKNLMLFAKICEKTVLKRVLKELWKIVLNTIE
RTIVLPPLNDQSQGAQMIFNAAKDLGQLSKLKEHVIREEARSLTPRQCAAMDLVLPTIKQ
YFHAGGNGLKKTFLEKSPDMKSLKYALSLYTQPTDALIKKYICTQTSQGQSSNGSVGEVS
MQVNLISHPGTGEHKVSVKVCEVNNLLWQTNAMFRPFVEVNAVGPHLADKKRKFSTKTKN
NNWSPKYNETFQYVLSNEHGPEAYELHVSVKDYCFAREDRIIGMAVIQLRELADKGSCSA
GYPLVKSISMDETGLTIMRILSQRTNDEVAKEFVRLKTDTRSTEEVS
Download sequence
Identical sequences G3PW41
ENSGACP00000021830 ENSGACP00000021830 69293.ENSGACP00000021830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]