SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021844 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021844
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-22
Family Ubiquitin-related 0.0000305
Further Details:      
 
Domain Number 2 Region: 241-304
Classification Level Classification E-value
Superfamily XPC-binding domain 1.96e-19
Family XPC-binding domain 0.0000834
Further Details:      
 
Domain Number 3 Region: 324-383
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000587
Family UBA domain 0.0004
Further Details:      
 
Domain Number 4 Region: 145-201
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000945
Family UBA domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021844   Gene: ENSGACG00000016541   Transcript: ENSGACT00000021885
Sequence length 384
Comment pep:known_by_projection group:BROADS1:groupXIV:4331919:4336540:-1 gene:ENSGACG00000016541 transcript:ENSGACT00000021885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQITLKTLQQQTFKIDIDEEETVKTLKEKIEQEKGKDNFSVAGLKLIYAGKVLSDDTALK
EYKINEKNFVVVMVTKAKTASAAPQPPPAAPAPSTAAAAPPASSSSSVSTSERASADDKP
EERRAPTAEPASAAVGSSEVSTNTNLIDEAVSNLVTGSSYDAMVNEMMLMGYEREQVVAA
LRASFNNPDRAVEYLLSGIPGRDVGLAAGPEAVVPPVSVQSAPIGGISLPANIGSSPSAG
GGNPLSFLRNQPQFHVMRQLIQQNAALLPALLQEIGRENPELLQEISSHQEQFIQMLNEP
NPEAVPAGGGGGGGVGGVGGVVAGDTPGGSHMSYIQVTPQEKEAIERLKALGFPEGLVIQ
AYFACEKNENLAANFLLQQNFDDD
Download sequence
Identical sequences G3PW55
69293.ENSGACP00000021844 ENSGACP00000021844 ENSGACP00000021844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]