SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021855 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021855
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000111
Family Ubiquitin-related 0.00053
Further Details:      
 
Domain Number 2 Region: 333-376
Classification Level Classification E-value
Superfamily UBA-like 0.00000000004
Family UBA domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021855   Gene: ENSGACG00000016549   Transcript: ENSGACT00000021896
Sequence length 380
Comment pep:known_by_projection group:BROADS1:groupII:16189337:16192775:1 gene:ENSGACG00000016549 transcript:ENSGACT00000021896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSDWHLSLKLADHPKSTFHFPDMMPGDVPPGGYRISTLKQLVAAQIPDSIPDPELMEL
VHCGRKLKDDLTLDACGILSGSTLHILKKIWPEPQSNPEPVNRATAAREFRVFHAALHSL
NSAYRDSVYKMLTNKESLDQIIVATPGLRSDPIALGVLQDKDLFVQFTDPNMLDILISSH
PALVNAIILVLHSVAGSIPPQASAGSSRNVSAGSYSDMPGGFMFEGMSDDEDDFQSGSPA
GPSSRAGGSAGIRPVSLSHSGATGPRPITQSELATALALASTPDSSAVTPTTSSQKADPP
GGVGPMPTGTPVSNDLFSQALQQALQASNMTALQGRWQSQMQQLRDMGIQDEDLMLRALQ
ATNGDIQAALELIFAGGPGL
Download sequence
Identical sequences G3PW66
ENSGACP00000021855 69293.ENSGACP00000021855 ENSGACP00000021855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]