SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021883 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021883
Domain Number 1 Region: 17-142
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-26
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 2 Region: 367-527
Classification Level Classification E-value
Superfamily Ras GEF 7.98e-21
Family Ras GEF 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021883   Gene: ENSGACG00000016568   Transcript: ENSGACT00000021924
Sequence length 658
Comment pep:known_by_projection group:BROADS1:groupIX:4551089:4556919:-1 gene:ENSGACG00000016568 transcript:ENSGACT00000021924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRARFLLHIFPAYRPPHMRRKELEEELKLSTDDPRSHAWFHGPLSREAAESLFERDGDFL
VRESSSSPGDYVLSCFWKDGPMHFKIIRVILRPKEGYSRELFQFEKDRFDNVPALIRFYV
GGRLPISQGSGAVIFHPITRTLPLRVIAERGVEPPARREKPSQANIRRSFSSEHADALEA
VNPLLRSGSQPANMENVGRGPSLQSAQSDSNLRTGLSVERCNKREAKASSETRGRNPVDP
STSCLVPSPSSRRSTERSFQGHGARPHLAGVSHGQRTPAEPPAATHAPLPPSLPTAQTRH
SVLRPCRWCCSEIIDKSISTKNVLKSLKCKDSMVSSSPTSLSPVTVESASCFQLDQFHSK
LLPENNRPLEPAVLLALKELFNRSKAEATALHMLSVDCQVARIVGVTDEQKTSMGVGSGL
ELVTLPHGSQLRKDLLERHHLIALGVAVDILGCTGTVSQRATVLHKLILLAQALKEHAHN
LYSFSAVMKALDMPQITRLEMTWRALRRNHTDTAVLFEKKLKPFMNLLNDGDDSVVSGPV
AVPHLVPLLMAMEGDDPVEDSERGCELLYDVLQAARRAALHAPDYQQHARALLAGSWEPV
PELLEAFRTEFALRLLWGHSGSLADKAERYEKFDKILHVLSDKLEPVVITPLQPDLLT
Download sequence
Identical sequences G3PW94
ENSGACP00000021883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]