SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021893 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021893
Domain Number 1 Region: 187-392
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-51
Family DBL homology domain (DH-domain) 0.000000173
Further Details:      
 
Domain Number 2 Region: 2-226
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.72e-37
Family Calponin-homology domain, CH-domain 0.0038
Further Details:      
 
Domain Number 3 Region: 379-542
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-28
Family Pleckstrin-homology domain (PH domain) 0.0056
Further Details:      
 
Domain Number 4 Region: 671-770,811-837
Classification Level Classification E-value
Superfamily SH2 domain 9.94e-23
Family SH2 domain 0.00075
Further Details:      
 
Domain Number 5 Region: 590-680
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000446
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 6 Region: 780-825
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000091
Family SH3-domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021893   Gene: ENSGACG00000016580   Transcript: ENSGACT00000021934
Sequence length 845
Comment pep:known_by_projection group:BROADS1:groupIX:4564183:4575611:1 gene:ENSGACG00000016580 transcript:ENSGACT00000021934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCAMWLIDCRVLPENHRVTWEGAQVCDLAQTLRDGVLLCQLLNNLLPQAVNLREI
NLRPQMSQFLCLKNIRTFLGVCQEKFHLKKSELFEAFDLFDVRDFAKVIDTLSILSHSFI
ATQGRLQPFPSEGCTPDEDIYSGLSDLIDDTVDGDDDLYDCVEDEENEGDEIYEDLMRTD
EHANTQPKAGVDKRECCLQEIRQTEEKYSDTLQSILQHFMKPLQRFLQAPDLESIFINIV
DLADTHRNMLEEVRSSILDHGAKNLYQVFLKYKERLLLYGHYCSQVEAATKHLDKLSNTR
EDIRMKLEECSNRANSRRFSLRDLLMVPIQRVLKYHLLLQELLKHTTDPAEKDNLRKALD
AMRDLAQCVNEVKRDNEIIRQITTFQLSIENMTQSLAFYGRPKIDGELKICSPEKKSKQD
RYAFLFDKAMFICKKKSGETFELKEIIELQYYQLRDETTGEKDNKKWSYLFLLLELNGRC
GYDLFFKTRELKKKWLEQFQMSLSNMCPDNSTANNHDFQMNCFEDTTSCKACSMLLRGIF
FQGYRCSRCKMAAHKECLGRVPACGRNFADHAGTVRKRSFCIKISRSPLPSSSLSLSGYP
KMEVCQEYYGLPPPPVGFGQPLPLCKGDIIELTRAEADLSWWEGRNLTIGQMGWFPGQNV
QPYISRPTSDLSGFNWFAGNMDRTAARNLLVSRSDGTFLVRQKDGGEFAISIKFNMDVRH
IKVTSTEGLYRINDKKAFKGLVEMIQFYQQNSLKEYFKDLDTTLCTPYKQPEQSYSPGGG
ARSFSAVRARYDFSARDRSELSLREGDTIKILSKKGHSGWWKGEVYGRVGFFPANYVEED
YSEYC
Download sequence
Identical sequences G3PWA4
ENSGACP00000021893 ENSGACP00000021893 69293.ENSGACP00000021893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]