SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021908 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021908
Domain Number 1 Region: 8-84
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021908   Gene: ENSGACG00000016595   Transcript: ENSGACT00000021949
Sequence length 732
Comment pep:known_by_projection group:BROADS1:groupIII:10919920:10930582:1 gene:ENSGACG00000016595 transcript:ENSGACT00000021949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLGEVAPVWVPDCQAPVCMKCDVRFTFTKRRHHCRACGKVFCATCCSLKCRLEYMDRKE
ARVCVTCHPALTSDRNLVSSVSLSAQSWETPATGSNQSPNPNNPAEYCSTIPPLQQAQAS
GVLSSPPPTVMVPVGVLKPSGNEATLTREQRRVWFADGLLPNGDTAESPKPPASSSTPSQ
PAPPLQPQAAHTTTAALVGSPVGSALSLIPEDGLPPILISTGVKGDYAVEEKPSEIVLMQ
QLEEENPDPLVFVLNANLLAMVKLVNYVNRKCWYMTTKGMHAVGQAEVVILLQCLPDEKT
IPKDIFTHFVQLYQEALSGSVLGHLSHSFFTQSFLGSKEHGGFLYISPSFQSLQDLLLPN
PPYLFGILVQKWETPWAKVFPIRLMLRLGAEYRFYPCPLFSVRFRKPLFGETGHTIMNLL
ADFRNYQYTLPVVKGLVVDMEVKKTSIKIPSNRYNELMKAMNKSNEHVLAMGACFNDRAD
SHLVCVQNDDGNYQTQAISIHHQPRKVTGACFFVFSGALKVSSGFLAKTSIVEALDGVMI
QITAETMDSLRQALRDMKDFSVTCGKADQQENQELVHIQWTEDDHDFNKGVISPIDGKSM
ESIISVKIFHGSEFKANGKVIRWTEVFFLQSEDQPSDPADHSRLTENVARAFCMALCPHL
KLLKEDGMAKLGLRVTLDSDQVGYLAGSNGQPLLPQYLSDLDSALIPVIHSGACQLSEGP
VVMELVFYILEI
Download sequence
Identical sequences G3PWB9
ENSGACP00000021908 ENSGACP00000021908 69293.ENSGACP00000021908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]