SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021954 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021954
Domain Number 1 Region: 16-742
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.02e-231
Family Motor proteins 0.00000000174
Further Details:      
 
Domain Number 2 Region: 1594-1678
Classification Level Classification E-value
Superfamily SH3-domain 0.00000405
Family SH3-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 2042-2149
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000212
Family Second domain of FERM 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021954
Domain Number - Region: 1953-2034
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000102
Family UBX domain 0.056
Further Details:      
 
Domain Number - Region: 2150-2244
Classification Level Classification E-value
Superfamily PH domain-like 0.0516
Family Third domain of FERM 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021954   Gene: ENSGACG00000016622   Transcript: ENSGACT00000021995
Sequence length 2265
Comment pep:known_by_projection group:BROADS1:groupIX:4636527:4665245:-1 gene:ENSGACG00000016622 transcript:ENSGACT00000021995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYSILSMPTTGHRAKSWAEGMEDMTQLPELNETTVLMNLKKRFDQELTYTYIGSILVSVN
PYKLLNIYGTDMVLQYEGRGLSDNPPHLFAIASLTYTTMMDAKRDQCIVISGESGSGKTE
ATKLILRYLTAIHHKCNVTQQVDILEATPLLESFGNAKTVRNDNSSRFGKYTQIYMEEGV
IGGAITSQYLLEKSRIVFQAKSERNYHIFYEMLAGLPPHEKHSLYLQEAETYYYLNQGGD
CTIEGKDDGMDFRRLLSAMDILRFTPEEQTSIYRLLSSVLHLGNVYFQPHQAEGQEVAAV
VSAQEIRVVAELLQVSPDGLQKSVTFKLTDTVREKILTPLTVESAVDARDAVAKILYSLL
FSWLTERINGRVYPRNEALSVSILDIYGFEELLKNARKTVCEAKKYYWRNSLVSNVTHEE
YMREQIKWQQQTFSHNQACLDLIAAKPHGILRILDDQCGFPQATDHTFLQKCHYHHGNNP
LYARPKMPQPEFTLKHFAGKVTYQVHKFLDKNFDMVRQDVLDLFIQSKNRMVSGLFLKHS
ESTSNARRSSAARRHQANTVSAKFQSSLQDLLEKMERCNSYFVRCIKPNQHKEPGVFDMD
LVNTQLHYSGIMETILIRKEGYPIRMHFHRFLKRYKALLCMKDPPPAEGENCVIMLHKLC
PVKSGSYQLGVSKIFLKEELYQLLEGKRDRLLNFAALTLQRYTRAGFVRRNFAKMRRRMI
LFESRCRGYLARKRFALRRKHLTRLRSAVLLIVSCQRYMRDRVNREVVNVTTLPVPAELA
VLLQAASGGEELHSDCLAVVQAPKVQVDPQLTLPLDINNYLMTHYIRAIFREPMFGMLTA
PLESSLIRMDEELKQGALNVFVLILRFMGDPNLNGAQENLFGNYIIQRGLANPSLRDEIM
AQVANQVWRNPNILNSERGWLLLSSCLSAFLPSQRLAKYLLKFVSDYGPEGYDCVCQHRL
LQALRRLSVGPEHVRTYPPCLLEWTANRKRAHTVLHTHCFDGVSFLCPLHSWTTGEEMAK
DILQHRGVVDGHRGWSVLLKEPAQLVELEGSDYVLDLMSDLELPADFPKRSSYFIISAQE
PGRVRPNASILIEACWAAALTQGVISYLQPYLDLMDKVHYYKCTLNCSPLVPTDSERQRG
MDRYLDSLFDPVLSEEVESAAGLSSRMKGVGGVGGGWQQQGQSTGPPPPPGGQSKAQHLS
KAIVNQQAVIMAQQMTMQAMAVLNSPMTSPPTSPVTSPPMSPLLHHPPSPYAPASPYAGV
PQSPYAAFALAPVVTAPPPPAGEVVKYSARTSDFLVPSQDIQDIIKRYNSPPPPGDLLPH
EKRRPEGKFKKKQTPRDEALQILKPQMPKRPAAPPPSASAVKEAGFKPTTKAKASDRPLP
VPPPVSRELPVETRTIQTQLHQRTNEEHYTYTNVPWRLYLRKEVFYPKDSFNNPLVLDLI
FKQIVNDTLSEECVRITRDERQRMKALFAKHGVEQNMDPVEEHVKKTIVSAARETWEIYF
SRLFPASGSVGTGVQVLSVSHGGIKLLKTVKSSAAAPDYFRVLRPYTYADILFVTIPSEN
MLEFNLTNEKLILFSAKAPQVKHLVDTFINEIKKDSDYVIAERNFVADDRSMLSFHKGDV
IRLQVMDGLEKGSSYGCVVRKKVVFLEDLKRDTQDFGWKFGAVIGRSGAFPADCVHPVAP
PGFLSLPLDRQAEPRGGAGQFAVSSAIAVAVASTAAAHEIDQTIEVSLDQFPEGDLDERA
LQDSKYDMSEFAKMFFRQAARGKGDSLKSKSRTRDSREPTEMIKFSKTPLTESLIEFTDA
AMNRVAADLFLLLMRFMGDSPSKGLTEQEVVNSILKLIGEFPLMRDEAYCQLLKQLTANT
SLKPDSCQRGWRLLYLLTAYHRCSEVLKPFLLKSLQQASRSAGAQYQGIAKACEQNLKKT
FRFGGRIVPPNSMELKAVMAGRSSKRQLFLFPGGIERHAKIKTCTVALEVIEELCYEMGL
HNLEAMEEYAIFLVTNRGQNVRPLNKHEYILDVATEAEVVDANYSFWFRRVVWTQALKFD
NELRVSMHYNQILPDYRKGLLNVLTLGKVSDQQFHQISKLAALQHRAKDVAFIPSIHELS
EYIAAPLFKKQPPQQWVTMVTQHMQQVQTLNPHQARAQFLGLISAFPMFGSSFFYVQSSS
STTFYAPCIIAVNQHGLHFLHKNTHELMAVVPLVEVQSSRTQRPTAGRSYPYVDLTLGDV
STQRVIQLQLEQGLELCRVIAMHVENMMSARERRLALPPSEITVL
Download sequence
Identical sequences G3PWG5
ENSGACP00000021954 ENSGACP00000021954 69293.ENSGACP00000021954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]