SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021956 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021956
Domain Number 1 Region: 217-383,691-909,956-987
Classification Level Classification E-value
Superfamily Ras GEF 1.44e-107
Family Ras GEF 0.00014
Further Details:      
 
Domain Number 2 Region: 364-452
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-18
Family PDZ domain 0.0049
Further Details:      
 
Domain Number 3 Region: 95-220
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000000000802
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 4 Region: 601-680
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000132
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021956   Gene: ENSGACG00000016624   Transcript: ENSGACT00000021997
Sequence length 1101
Comment pep:known_by_projection group:BROADS1:groupIV:2496016:2509522:1 gene:ENSGACG00000016624 transcript:ENSGACT00000021997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQLPADFSRLHLADGLHPQGPHVSSSHSGCSITSDSGSSSLSDIYQATENEPGDMDLSGL
PETAVDSEEDDDEEDIERASDPLMSRDIVRDCLEKDPMDRTDDDIEQLLEFMHQLPAFAN
MTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPEGRTEILCMGNS
FGVSPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHR
ELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTYIEDFLLTYRTFLSSPMVVGKKLLE
WFHDPSLRDKVTRVVLLWVNNHFNDFEGDSAMTRFLEEFENNLEKEKMCGHLRLLNIACA
AKAKPRLVTLTKPSRDSPLAFSLLGGQEKGFRIFLDAVEPGSKAAEVGLKRGDQILEVNG
QNFENVQLIKANEILKNNTHLSITVKTNLLVFKELLTRPEQDHDADGEEEHDRKNGAPHL
PKIGDIKKASRYSIPDLAVDVEQVMGLEKASKKAKSNSVGGRNKLKKIFDKTLTSILPPK
PYNDVCVGQSQDDSIVGMKQSKQIAPALPVSGNLSSSNPDLLQSHHRILDFNNQPDMSDQ
VLRVFKADQQSRYIMIGKDTTAKEVVAQAIREFALTAAPEAYSLCEVSVTPEGVIKQRRL
PDQLSKLADRIQLSGRYYLKSNMETETLCSDDDAQDLLREGQISLLQLSTVEVATQLSMR
AFELFCAIEPTEYIDDLFKHRSKAGSASLKRFEEAINDETFWVATEVTREPNQIKRMKTV
KHFIKIALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFGDLQDLFDPSR
NMAKYRNVLNNQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVG
RMASVNMDPALMFRTRSLGQGSANAAVLDVTQTGGHKKRVRRSSFLNAKKLYEDAQMARK
VKQYLSHLSLESNEESLQTLSMQCEPSISTLPKNAGGKRPDTSPVVSRAATQQRGQLAKG
NQALQVPAVALYPSRKKVPVKDLPPFGTSSPHSLKKILSLSEEENERHRRQPEDTVSNAS
SQLSSPPTSPQSSPKKGKPII
Download sequence
Identical sequences G3PWG7
ENSGACP00000021956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]