SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021958 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021958
Domain Number 1 Region: 95-261,569-787,842-873
Classification Level Classification E-value
Superfamily Ras GEF 1.31e-107
Family Ras GEF 0.00014
Further Details:      
 
Domain Number 2 Region: 242-330
Classification Level Classification E-value
Superfamily PDZ domain-like 3.42e-18
Family PDZ domain 0.0049
Further Details:      
 
Domain Number 3 Region: 3-99
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000000304
Family cAMP-binding domain 0.0016
Further Details:      
 
Domain Number 4 Region: 479-558
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000114
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021958   Gene: ENSGACG00000016624   Transcript: ENSGACT00000021999
Sequence length 982
Comment pep:known_by_projection group:BROADS1:groupIV:2500556:2509507:1 gene:ENSGACG00000016624 transcript:ENSGACT00000021999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPEGRTEILCMGNSFG
VSPTMEKEYMKGVMKTKVDDCQFVCIAQQDYCCILNQVEKNMQKVEEEGEIVMVKEHREL
DRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTYIEDFLLTYRTFLSSPMVVGKKLLEWF
HDPSLRDKVTRVVLLWVNNHFNDFEGDSAMTRFLEEFENNLEKEKMCGHLRLLNIACAAK
AKPRLVTLTKPSRDSPLAFSLLGGQEKGFRIFLDAVEPGSKAAEVGLKRGDQILEVNGQN
FENVQLIKANEILKNNTHLSITVKTNLLVFKELLTRPEQDHDADGEEEHDRKNGAPHLPK
IGDIKKASRYSIPDLAVDVEQVMGLEKASKKAKSNSVGGRNKLKKIFDKTLTSILPPKPY
NDVCVGQSQDDSIVGMKQSKQIAPALPVSGNLSSSNPDLLQSHHRILDFNNQPDMSDQVL
RVFKADQQSRYIMIGKDTTAKEVVAQAIREFALTAAPEAYSLCEVSVTPEGVIKQRRLPD
QLSKLADRIQLSGRYYLKSNMETETLCSDDDAQDLLREGQISLLQLSTVEVATQLSMRAF
ELFCAIEPTEYIDDLFKHRSKAGSASLKRFEEAINDETFWVATEVTREPNQIKRMKTVKH
FIKIALHCRECKNFNSMFAIISGLNLAPVSRLRGTWEKLPSKYEKLFGDLQDLFDPSRNM
AKYRNVLNNQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRM
ASVNMDPALMFRTRKKKWRSLGNMSQGSANAAVLDVTQTGGHKKRVRRSSFLNAKKLYED
AQMARKVKQYLSHLSLESNEESLQTLSMQCEPSISTLPKNAGGKRPDTSPVVSRAATQQR
GQLAKGNQALQVPAVALYPSRKKVPVKDLPPFGTSSPHSLKKILSLSEEENERHRRQPED
TVSNASSQLSSPPTSPQSSPKK
Download sequence
Identical sequences G3PWG9
ENSGACP00000021958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]