SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021982 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021982
Domain Number 1 Region: 3-305
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.68e-86
Family G proteins 0.000000000195
Further Details:      
 
Domain Number 2 Region: 522-629
Classification Level Classification E-value
Superfamily PH domain-like 3.64e-23
Family Pleckstrin-homology domain (PH domain) 0.00000209
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021982   Gene: ENSGACG00000016647   Transcript: ENSGACT00000022023
Sequence length 847
Comment pep:known_by_projection group:BROADS1:groupXIV:5337397:5373235:-1 gene:ENSGACG00000016647 transcript:ENSGACT00000022023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNQGMEDLIPLVNRMQDAFSAIGQNSNLDLPQIAVVGGQSAGKSSVLENFVGKDFLPRG
SGIVTRRPLVLQLMNCPTEYAEFLHCKGKKFVDFDEVRQEIEAETDRITGANKGISAVPI
NLRVYSPNVLNLTLVDLPGMTKVPVGDQPADIEAQIREMLMQFVTKENCLMLAVSPANSD
LANSDALKIAKEVDPQVGMRTIGVITKLDLMDEGTDAKDILENKLLPLRRGGYIGVVNRS
QKDIDGRKDINAAMTAERKFFLSHPSYRHLADRMGTPYLQKILNQQLTNHIRDTLPNLRA
KLQSQLLSIEKEVEEYKNFRPDDPSRKTKALLQMVQQFSVDFEKCIEGSGDQIDTAELSG
GARINRIFHERFPFELVKMEFDEKELRKEISYAIKNIHGIRTGLFTPDMAFETIVKRQIG
KIKEPCAKCVDMVISELVITVRQCTKKLAQYPSLREEMERIVTQHIRDRENRTKNQVMLL
IDIELSYMNTNHEDFIGFANAQQRINQMNKKKAAGNQDEIMVIRKGWLTINNISIMKGGA
KEYWFVLTAESLSWYKDDEEKEKKYMLQVDNLKLRDVEKGFMSSKQIFALFNTEQRNVYK
DYRQLELACETQEDIDAWKASFLRAGIYPERVTDKEGKSDGGDENGSDNIMHSMDPQLER
QVETIRNLVDSYMAIVNKTVRDLMPKTIMHLMINNTKEFINADLLAQLYSCGDQNTLMEE
SQEQAQHRDEMLRMYHALREALSIIGDISTSTITTNMPRPGDDSGLQGQRSGPGERSPAT
SPTPNRRAPPGRPGSRGPPPGPPPAGGPPVPSRPGASPDPYSGPPPTVPSRPNRAPPSVP
RITITDQ
Download sequence
Identical sequences G3PWJ3
ENSGACP00000021982 ENSGACP00000021982 69293.ENSGACP00000021982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]