SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022015 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022015
Domain Number 1 Region: 299-441
Classification Level Classification E-value
Superfamily PH domain-like 1.81e-39
Family Third domain of FERM 0.00000872
Further Details:      
 
Domain Number 2 Region: 195-300
Classification Level Classification E-value
Superfamily Second domain of FERM 7.2e-36
Family Second domain of FERM 0.0000031
Further Details:      
 
Domain Number 3 Region: 115-194
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.26e-23
Family First domain of FERM 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022015   Gene: ENSGACG00000016674   Transcript: ENSGACT00000022057
Sequence length 1094
Comment pep:known_by_projection group:BROADS1:groupIII:11266272:11286371:-1 gene:ENSGACG00000016674 transcript:ENSGACT00000022057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSESGADSEAKQPRENKETEKEKGKAKAAAAAEPASPQNQPEQFPAAAGHSTPASKDNR
EVQWKTTINDLTHYSLNSLSLSQEQQEVDQVSHRSSISRLSRSPLKGVKKTKIMECKVAL
LDGSDFTLNLEKRARGHVLFDKICEHLNLLEKDYFGITCRDVENQKNWIDPGKELKKQIR
TGPWNFAFNVKFYPPDPAQLTEDITRYYLCLQLRDDVVSGRLPCSFATHTVLGSYAVQSE
LGDYDPEELGSDYISELRFAPNQTKELEEKVMELHKTYKGMTPAEAEIHFLENAKKLSMY
GVDLHHAKDSEGVEIMLGVCSSGLLIYRDRLRINRFAWPKILKISYKRNNFYIKIRPGEF
EQFESTIGFKLPNHRAAKRLWKVCVEHHTFFRLVSPESQPKKFLSLGSKFRYSGRTQAQS
RRASSMINRLAPLVERSSSKRYNMSLSLDGAPIAENHETPMKDSAAAGAAKILTKGDLIT
TVTTEKKAEEEKAEQEDAPTDAAETQEPTTPLRHDTKCSSHVYTTDPLRSELSLPSSPVS
SPKVRRRRRENARKRASSVSPAKSTAGCRRRQAHADRKAALLDEQVLLLSARKQRLEQGK
SRGGTLFSFSLHLPDLSSLLDEDGYISFPDLSEMRFLPMCAQNFMAISNDNLKLLFVILL
FYLLCSTQQMCHLLQVGFLLFSCLPLGTVSVCLRMQTDSEQTDFAFDGEMTATESDADDD
SEMRTQDTSPPEEMLKHQTNISELKRSFLETGESSPGLTEWEKRLSSSPAHSPRGDEAPM
IEPLELQDVSRGPRAGSKDPSEVCVMSHSAIKGTDSPKKAMASWISEVVKTEATEVVGAS
TKASDAPQPGEENKTLQTMVLALEEELLGLNDTGERKHTEVDGRRVQFSNQEANKERDKC
SRAEDESQKSSPDNLKRLPFEKEKYYRAQMDRSEDGVETTDGEEEAPEEEHGPSGTFLKA
VHSGAFSEIPGCDVVEVGTKEVPVVHTETKTITYESAEVETNGDVDPGVLLSAQTITSET
TSTTTTTHITKTVKGGISETRIEKRIVITGDTDIDHDQALAQAIKEAKEQHPDMSVTKVV
VHKETEITPEEGED
Download sequence
Identical sequences G3PWM6
ENSGACP00000022015 ENSGACP00000022015 69293.ENSGACP00000022015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]