SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022040 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022040
Domain Number 1 Region: 27-95
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000751
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022040
Domain Number - Region: 166-213
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00118
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022040   Gene: ENSGACG00000016695   Transcript: ENSGACT00000022082
Sequence length 236
Comment pep:known_by_projection group:BROADS1:groupIV:3155291:3161766:-1 gene:ENSGACG00000016695 transcript:ENSGACT00000022082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRNQLQSVYKLDPLRNEEEVKLKIKDLNEHIVCYLCAGYFIDATTITECLHTFCKSCI
VKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVFKLVPGLQESEDKRIKEFYQSRGL
ERVIQPTGDGLPYTSFDHSKAHFYRYDEQVSLCLERLSSSLAGKDKQKFVRCSVRAEVRH
LRRVLCHRLNVEKQQVQMLFNNESLPDHMTMKRLWLSHWFGKDHPLRRFHRPPIEL
Download sequence
Identical sequences G3PWQ1
ENSGACP00000022040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]