SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022054 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022054
Domain Number 1 Region: 761-967
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.41e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.0000822
Further Details:      
 
Domain Number 2 Region: 245-504
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.78e-37
Family FCH domain 0.029
Further Details:      
 
Domain Number 3 Region: 686-739
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000314
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022054   Gene: ENSGACG00000016701   Transcript: ENSGACT00000022096
Sequence length 1344
Comment pep:known_by_projection group:BROADS1:groupIII:11490060:11513119:1 gene:ENSGACG00000016701 transcript:ENSGACT00000022096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRKGSAGGGGTKNTRVLPRPLSKLHAGSLSAGSTKTWDVGRGLEGPNPLSSMGLTPHPV
GATGVDPDYVMRLVNDVRGFADVLLNLKEAFQLKENLEGLQVLVQERLAELLRVLKAIIG
QHQTLNSADILGAAGTVIAKVKAVNFKEENQEYTKAIFGEIHASIDNLAFTFGNVVSDFL
MGDVDSGSGLGIPQTRRSRSFDNICVDPEGYASEKNDLVAHSPGPAVSLTREEEVDLTLL
KNDSGVESALLYAKAWSKYIKDLLAWMEKRLAMDIEYAKSYAKMADSAKQLASQQVYMPF
SEVYISTFKNDIESNQLLIQTAMALQTNKFIQPLLARKSELDKLRKDLKEQWQREQKKMQ
EADATVRKARVLKGQRREEYQKARSSTNRSQEEQSNTANKQLEKKRKLEEDALQKAEEAR
DQYQSCMADAGVRRMDLANAKSTILTQIREMVFQCDLTLKAVTVNWFQMQQVQSTSFPTH
YQALSESTKLYEPGECYAEFVRNLPRNLPKERVHLDSTSSDNTSSNKIRFVFNKRSVGST
HSSHGNLSQASIASCDVLSGDEADSPVHRPAKISERMSNSSTDIQAVRSQTTLATWASSS
QGSQGGMCSDSESAGGSSESRSMDSPTASPGVFKRRLPRTPSTGTMSSADDLDEREPPSD
NGIGLAEMVTETASSPGPFRNAQMSKAAQTHKLRKLRAPSKCRECDSLVVFHGAECEECS
LACHKKCLETLAIQCGHKKLQGRLQLFGIDFAQASKNSLDGVPFIIKKCTSEIESRALNI
KGIYRLNGAKSRVEKLCQAFENGKDLVELSDLSPHDISNVLKLYLRQLPEPLILYRYYND
IIGLAKECSRVIVEEADKPPSAPPGEKGEASMQLNRVIFKIRDLLRQLPTANYRTLRFLI
AHLHSRVTEQAEENKMTASNLGIIFGPTLVKPRQADAEVSLSSLVDYPYQALMVEFLVRH
FQTVFDVSLLCSSDNTVTGQASPRLTPLEKLQRLSRHSASLTDFKESAKVFKRYSSVIPS
SHIMDEVPEVQPATNPSEVSAPDRLNGKQSPSEGDVQRSTLVFGRPSTTVPSTTAVPPKV
QLRTQRTRNVSRPISMPLERLPNRAQISERNQRNGATKDEASSAERDPVSETIQEIPEPE
KARQSGSSRVSTYYITPFYDTQTVQRKTWDRKYKHYDVTPRTAKIVANLPSATSGVQPPG
WTSKREDDADNSVGKSSSSPNQMLTLRAPRTLQPPPGTFYKPPVPINHRARTLPNWTTAA
SLAPTXHSNPVVTLSSAPSSPTQTQDPTGSVMDAGVSTFATLSPPQSPPPSSPDDLSPTE
TKPVYQRLRPRQMQEPERREAHFV
Download sequence
Identical sequences G3PWR5
ENSGACP00000022054 ENSGACP00000022054 69293.ENSGACP00000022054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]