SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022105 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022105
Domain Number 1 Region: 49-224
Classification Level Classification E-value
Superfamily Sec7 domain 8.63e-49
Family Sec7 domain 0.00011
Further Details:      
 
Domain Number 2 Region: 263-394
Classification Level Classification E-value
Superfamily PH domain-like 6.7e-28
Family Pleckstrin-homology domain (PH domain) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022105   Gene: ENSGACG00000016743   Transcript: ENSGACT00000022147
Sequence length 547
Comment pep:known_by_projection group:BROADS1:groupXIV:5524124:5529441:1 gene:ENSGACG00000016743 transcript:ENSGACT00000022147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEPKTGESQATQHLSAEPGVAREAADEAGGGEEGSAQPVAAREERAEPPEGAAPLMNG
DAVNGEMARRLAERLRGLDGIQRADVVKHLDKDNDFSRAVGEEYLKLFDFTGQTLDHGLR
SFLKVVVLIGETQERERVLQHFACRFHHCNPDSFTSSAPESVLALTCALMLLNTDLHGQN
VGKSMSSAKFVSNLDGMNEGENFSKDLLKSLYNSIKSEPLQWAVDEEELKSSVLVDEDAA
EDAPLRSKSNPFQDVPHDKTASVVKQGFLQRKLHADIDGKRTPWGKRGWKTFYGVVRGMV
LYLQKDDYRRDQPIDEEVVSLHHSLAEQAADYTKKPHVFRLQTADWRVLLFQASSKLEMH
SWISRINLVSALHSSPPFPAAVGSQRRFCRPILPSSQSGHTPERQLQSYAGTLKSFKDDL
SYLQENLPEGKRAKAKELEEHRVRAEYLHHEMCRYEIYIQGLEAWRSVTKAVGSAPSVAD
LNRFDKAVCAFSPEEEEEEDEGRLKKSHSSPSLELEIAPPALIKVRRNISERRTYRKTII
PRWNKEV
Download sequence
Identical sequences G3PWW6
ENSGACP00000022105 ENSGACP00000022105 69293.ENSGACP00000022105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]