SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022152 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000022152
Domain Number - Region: 21-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0694
Family Ubiquitin-related 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022152   Gene: ENSGACG00000016780   Transcript: ENSGACT00000022194
Sequence length 146
Comment pep:known_by_projection group:BROADS1:groupIX:5251670:5254663:1 gene:ENSGACG00000016780 transcript:ENSGACT00000022194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSCVHYKFSSKLDYNTVTFDGLHITLNELKKQIMGRERLKATDCDLQITNAQTREEYTDD
EVHIPKHSSVIVRRTPLGGVKPAGRTFIVDRSDTAVVGSSRPVCKTNPKSTPLVTFLENI
VSGKCILKGFVKKNESCKTRLSSEPL
Download sequence
Identical sequences G3PX13
ENSGACP00000022152 69293.ENSGACP00000022152 ENSGACP00000022152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]