SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022157 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022157
Domain Number 1 Region: 191-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-48
Family DBL homology domain (DH-domain) 0.000000461
Further Details:      
 
Domain Number 2 Region: 2-228
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-38
Family Calponin-homology domain, CH-domain 0.004
Further Details:      
 
Domain Number 3 Region: 380-541
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-34
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 4 Region: 632-753
Classification Level Classification E-value
Superfamily SH2 domain 2.77e-26
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 5 Region: 786-843
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-21
Family SH3-domain 0.00075
Further Details:      
 
Domain Number 6 Region: 582-660
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000249
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022157   Gene: ENSGACG00000016779   Transcript: ENSGACT00000022199
Sequence length 849
Comment pep:known_by_projection group:BROADS1:groupIII:11775930:11807770:-1 gene:ENSGACG00000016779 transcript:ENSGACT00000022199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCAMWLISCKVLPANHRVTADTAQVFDLAQTLRDGVLLCQLLNNLRPHTINLKEI
NLRPQMSQFLCLKNIRTFLTCCCNVFGMKRNDLFEAFDLFDVRDFVKVVDTLSKLSYTAI
AQQGVIKPFPTEESLKDEDIYNNLEDLIDENAPDDEDGLYAEVYGVEEDYAGGEIYEDLM
RNEQHPLKQTEVDVRSCCLTEIKQTEEKYTETLESIEKYFLNPLRNFFSAAEIDKVFVNI
PTWIKVHKSLMGDVQDSILYKNALNLYQIFISYKERLLIYGTYCSQVEIAIAVLDLISKE
KEDVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDAADKSNLKIAL
DAMKDLAQFVNEVKRDNETLREIDQYQRSIENLNQPLISYGRPKGDGEVRMVSSVDKRKQ
DRHIFLFDVAVIVCKRRGDNYEMKDILDLNNFKITNNPTTDREGKKWCCGFYVTHQQGHA
GFELFFKTRELKKKWLEQFEMAISNIRPDKANHNTHQFKMHTFERITSCSFCHLLLRGIF
NQGYQCVKCKLGAHKECLGRLGICGKTGENQYGILKRRRHKMQVPVQNKIPVSLGLPRML
VIRDYSGIPVPQCGPPLGIHAGDVIELMFADVHSSWWQGKILATSKIGFFPSDAVRPCPC
VPKPVDYSSQLWFAGPFERYQAEVELLDRDNGTYLVRHRSKECTEYAISIKFNDKVKHIK
ILTKDGCFYIAESQLFKTVLDLVEYYRRHSLKEGFSSLDTNLQVPFRELSNGSLPKAITR
AGMFSPRVVGVAVARYDFCSRDTRELSLLQGDIIKIYTKMSNGWWKGEIDGRMGWFPSTY
VEEEYSAFC
Download sequence
Identical sequences G3PX18
69293.ENSGACP00000022157 ENSGACP00000022157 ENSGACP00000022157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]