SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022158 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022158
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily PH domain-like 6.89e-40
Family Phosphotyrosine-binding domain (PTB) 0.00000464
Further Details:      
 
Domain Number 2 Region: 303-406
Classification Level Classification E-value
Superfamily SH2 domain 8.48e-19
Family SH2 domain 0.000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022158   Gene: ENSGACG00000016784   Transcript: ENSGACT00000022200
Sequence length 415
Comment pep:known_by_projection group:BROADS1:groupII:18410889:18418087:-1 gene:ENSGACG00000016784 transcript:ENSGACT00000022200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYIVQYMGSVEVTQSMRTLDFDMRMKVTREAISRLCERTSAAKTKKVKHQPVCKGLPALL
GQINLQFSGSRIVLTVSTDSVTMITASSFQKIAHHPMQAVSFASGGDPDMANYIAYVAKD
LVNQRACHILECPRGRASEVINSIGQAFENRFRQLLNHTPSLLSNRLSFCRLGGFHANQE
VEASEQRDYYNVVPRKTPSAGGIKDLVITSVENKQDPDIFGVRVTLTLDIYLASGRPEKN
QNKKFNFSPKLSNASPAQYIECLNDSSSAVAEETSAPPAGKTHPYTARDFSEKPHQSVAC
ETSAERSETLIQDLIQEEVWFHGRLGRDQAESLLTCSGDFLVRESSSASGQYVLSGMEGA
TVRHLLLVDPLGQVQGFGAGYQSVGHLVRFHMENKMPIISGSIELCLRQPILQRH
Download sequence
Identical sequences G3PX19
ENSGACP00000022158 69293.ENSGACP00000022158 ENSGACP00000022158

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]