SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022171 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022171
Domain Number 1 Region: 19-69
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000189
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022171
Domain Number - Region: 176-218
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0121
Family Ubiquitin-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022171   Gene: ENSGACG00000016794   Transcript: ENSGACT00000022213
Sequence length 245
Comment pep:known_by_projection group:BROADS1:groupIV:3892622:3899289:1 gene:ENSGACG00000016794 transcript:ENSGACT00000022213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQNPDMLTRKIKLCHINAHITCRLCDGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTC
RIVIHQSHPLQYIGSSCSVPIPLMILIGLIISQTRKTSSKSHLEQRARWHVSDQTRSIEV
ELTLVFCAGDTKSEETANKEAGEEKPEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRC
SAQATVLHLKKFIAKKLNLTSFNELDILCTRKILGDHTLKFVVVTRWRFKKSPLLLHYRP
KMDLL
Download sequence
Identical sequences G3PX32
ENSGACP00000022171 69293.ENSGACP00000022171 ENSGACP00000022171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]