SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022225 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022225
Domain Number 1 Region: 426-633
Classification Level Classification E-value
Superfamily PUA domain-like 3.98e-74
Family SRA domain-like 0.0000000148
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.99e-17
Family Ubiquitin-related 0.00012
Further Details:      
 
Domain Number 3 Region: 710-765
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000299
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 4 Region: 341-394
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000062
Family PHD domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022225   Gene: ENSGACG00000016831   Transcript: ENSGACT00000022267
Sequence length 790
Comment pep:known_by_projection group:BROADS1:groupXIV:5942027:5962495:-1 gene:ENSGACG00000016831 transcript:ENSGACT00000022267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTIDGKETRTVEDLSRLTKIESLRLKIQEIFSVSPHQQRLFYRGKQMEDGQTLFD
YNVGLNDIVQLLIRSQTDAPDSPAAKDSSVACGSGPPSSDPSPPADTQPPTSSRNALVDP
GIGVYKINELVDCRDVSIGAWFEACLENVTRAPKGQIMPTKGKVGRPPKRTNDNVGLSSE
SNGASTSQMDSTAATESKEREEDVVYHIKYEDYPENGVVEMRPVDVRPRARTLLRWDQLQ
VGARVMVNYNMETPDERGFWFDGEVQTVNQASRTNRELRVKILLGGAGDVIGDCKVQFLD
EIYQVETPGARPLSASDGQFKRKSGPECKHCKADPEAECRFCSCCVCGGKQDAHMQLLCD
ECNMAFHIYCLNPPLATIPDDEDWYCPTCKNDTNEVVKAGEKLKASKKKAKMPSATTESQ
RDWGKGMACVGRTKECTIVPSNHYGPIPGVPVGTTWKFRVQVSEAGVHRPHVGGIHGRSN
DGSYSLVLAGGFEDEVDRGDEFTYTGSGGRDLSGNKRIGEHSFDQTLTHMNRALALNCDA
PLNDKDGAESRNWRAGKPVRVVRSSKGRRISKYAPEEGNRYDGIYKVVKYWPEIGKCGYL
VWRYLLRRDDLEPAPWTPEGLERIKKLGLSVQYPPGYLAAMANKTKKEACARPGRGGRAE
SSPAAEPPSKKVKMEETFQLSEQQQQLIREDTANKKLWDEAMGYLKEGPNFLQKMEPIFM
CVCCQELAFQPITTACSHNVCKTCLQRSFRAQVYTCPACRHDLGKDYVMSQNATLQVLLD
QFYPGYSKGR
Download sequence
Identical sequences G3PX86
ENSGACP00000022225 69293.ENSGACP00000022225 ENSGACP00000022225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]