SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022229 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022229
Domain Number 1 Region: 357-485
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-35
Family Ran-binding domain 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022229   Gene: ENSGACG00000016825   Transcript: ENSGACT00000022271
Sequence length 542
Comment pep:known_by_projection group:BROADS1:groupIII:12141639:12150539:-1 gene:ENSGACG00000016825 transcript:ENSGACT00000022271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLANEDKPAIAPPVFVFQKDKAQKVSVFFSFSFDAILNTFVDLILYGHSVDSNLETLK
AGELLSSNLLLQRSAEGSSAEDGEDSDKDEGGYCPPVKRERTSSFPPPHSEEKPMGFRLK
PPTLIHGQAPSSGVPSQKPKEQQRSVLRPAVLQAPPSKSHIESNSICGTNGVKKSSDGEA
VTPSLFLNNTEHSASARSQVRCLKEMEKHENEEDGASGNKDEKETDVAISFVFGQNIKDR
AKLEENSKEGKSKDGLPLDSQSEGTNYFLQYISTPSSKNPANSTDDGAKFVFGQNMSERV
LSPPKGESLVEENKEVSAAPAAEPPSQEATPEKVNSVSESLEESAAAYTKATAKKCILEK
VDVKTGEESESNVLQMQCKLYVFEKTAQSWIERGRGLLRLNDMASTEDGTLQSRLVMRTQ
GSLRLILNTKLWPQMQVDKASEKSVRITAMDTEDQGVKVFLISASSKDIGQLAAALHHRI
LALKSKADQEPEAPTTTIPEAGLPQSNEDDSDEEDDASASASASTPATSNSEGGEGQAAG
ST
Download sequence
Identical sequences G3PX90
ENSGACP00000022229 ENSGACP00000022229 69293.ENSGACP00000022229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]