SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022233 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022233
Domain Number 1 Region: 256-384
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-35
Family Ran-binding domain 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022233   Gene: ENSGACG00000016825   Transcript: ENSGACT00000022275
Sequence length 441
Comment pep:known_by_projection group:BROADS1:groupIII:12141639:12150537:-1 gene:ENSGACG00000016825 transcript:ENSGACT00000022275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSFCQSPTGNSDSEPEEKPMGFRLKPPTLIHGQAPSSGVPSQKPKEQQRSVLRPAVLQ
APPSKSHIESNSICGTNGVKKSSDGEAVTPSLFLNNTEHSASARSQKHENEEDGASGNKD
EKETDVAISFVFGQNIKDRAKLEENSKEGKSKDGLPLDSQSEGTNYFLQYISTPSSKNPA
NSTDDGAKFVFGQNMSERVLSPPKGESLVEENKEVSAAPAAEPPSQEATPEKVNSVSESL
EESAAAYTKATAKKCILEKVDVKTGEESESNVLQMQCKLYVFEKTAQSWIERGRGLLRLN
DMASTEDGTLQSRLVMRTQGSLRLILNTKLWPQMQVDKASEKSVRITAMDTEDQGVKVFL
ISASSKDIGQLAAALHHRILALKSKADQEPEAPTTTIPEAGLPQSNEDDSDEEDDASASA
SASTPATSNSEGGEGQAAGST
Download sequence
Identical sequences G3PX94
ENSGACP00000022233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]