SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022301 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022301
Domain Number 1 Region: 526-851
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.83e-56
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 98-184
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000401
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0034
Further Details:      
 
Domain Number 3 Region: 5-55
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000748
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0075
Further Details:      
 
Domain Number 4 Region: 333-396
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000646
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022301
Domain Number - Region: 242-299
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00217
Family Ras-binding domain, RBD 0.038
Further Details:      
 
Domain Number - Region: 65-118
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0272
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022301   Gene: ENSGACG00000016877   Transcript: ENSGACT00000022343
Sequence length 879
Comment pep:known_by_projection group:BROADS1:groupIV:4928214:4939718:-1 gene:ENSGACG00000016877 transcript:ENSGACT00000022343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAPGHCLKRVTLTKPTFCHNCSDFIWGLVGFLCEVCNFMCHEKCLKTLRWACSCMTPSL
VRVPVAHCFGPSGQKKRFCSVCRKLTEGNGALRCEAVCELHVHADCAIFSCADCRSSHLD
ETLEQDTFHHHWREGNLASAARCDVCRRSCGSSDVLSGMRCEWCGVTSHASCYLGVPPEC
TLGRLRCMTLHPDRVRLHFRNFSKMHCYRIAESCSQELDNSDDVDQNAAASKEGPETATS
KQLKVFDGDDAMKRGCFRLVSIMRAIKNEEVVEAALRAFYLPDDPQDFELKEVSYTHRLH
SDDILNRNGGTDNRGGSLKDGGDAWLLRAKPRDPEVIKVYMARPRSGAAVVSVSVSKEST
AASVLSEVLSLLQRQEEDASSFSLMEVYMSSKQVQRQTLTPQEKIQDKLQEIRKVSLRQM
NQTRFYLVEDRKSAVQVSLLIGGLTPQLNRDEYVQLIQEQLTMKSHLVTLSHVYPSQGAV
ALQVSCFSEAERIYMLAKDTSVNNKALTSLVIAEIEHGAPREDVCPLLVFVNPKSGGMKG
RELLYGFRKLLNPHQVFDISNGGPLAGLHTFREVPKFRVLVCGGDGTTGWVLGVLEAIRH
KLVCREPPIGIVPLGTGNDLARVLRWGAGYGGEDPHHILVSVDEADEVLMDRWTILLDAQ
DISEDGKENGFLEPPKIVQMNNYFGLGIDADVSLDFHQAREDEPDKFTSRFHNKGVYVKV
GLQKISATRSLHKELRLQVDGRDVPLPHIEGLIFLNIPSWGSGADLWGSEVDVRHGKPRI
DDGMLEVVGVTGVVHMGQVQSGLRSGIRIAQGTYIRLTVNKPIPVQVDGEPWIQSPGHII
ISAAGPKVRMLKKSKQKQKKSSAGSKDKRSESPSSKEGG
Download sequence
Identical sequences G3PXG2
ENSGACP00000022301 ENSGACP00000022301 69293.ENSGACP00000022301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]