SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022353 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022353
Domain Number 1 Region: 106-635,802-992
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.19e-209
Family Motor proteins 0.0000000485
Further Details:      
 
Domain Number 2 Region: 1638-1813
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.44e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.0000765
Further Details:      
 
Domain Number 3 Region: 1555-1610
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000867
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0076
Further Details:      
 
Domain Number 4 Region: 2-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000331
Family Ras-binding domain, RBD 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022353   Gene: ENSGACG00000016918   Transcript: ENSGACT00000022395
Sequence length 1937
Comment pep:known_by_projection group:BROADS1:groupIII:12322870:12341345:1 gene:ENSGACG00000016918 transcript:ENSGACT00000022395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQIYPRLSQDTATYCPLQVGAGDTARTVIHNAVVTLGLDATKTYSLLEVRRAGREETLLE
AGERPLERVMLWPPRAHRWHPQCNGYYFILQDQHANNGGHQAENSSLCHDDLCNLQTVTE
ENILEALRQRFNRLKIYTYARNILIAINPNKFLPLYYNPNYVKMYEKQPLGKLSPHIFAV
ADSALRAMLSRQVNQCIVLSGESGSGKTESCSYLVHCLTSLSQKTYSGGLERTVLGAGPV
LEAFGNAKTAENNNSSRFGKFIQLNYLESGVIRGAVIEKYLLEKFRLVSRDPGERSYHVF
YYLLVGASKEEQQQFHLLKPQDYVYLQQEDLHLDDVEKLGREYKRLHQAMEMVGFLASTK
NHIFSILSAVLLLGNVTYTQSEDAEVLDVGPAEVLSTLSNLLKVKTEVLVKTLVKRRVVT
AGAAVLSQYTLQEATAVRDSMARSLYGALFDWIILHINHAMFNRRDMEESVPCLSIGVLD
MFGFENLRLQAGASQCFLHLNLIRLRWWSAFILSARAEDYVSEGIAWRTINYTDNSRCIR
LISEESTGLFALLDEESNLPQATDETLLDKLKQRHGDNPSVLPSSHREPTFIIQHFAGRV
KYHIKGFRQKNTEHIRPEVISLLRSSERAFVHHLVASSPEALFRWGVLRATIRILTVFKK
LGRQRAESRSKCICLKKRLLTYASQRKLNPKLKKYFSDIHSNSLPLDFSFDRSDEHPLDV
FEDIFVNYEKRKLNEASLFSFPQEKSRQSTKAAHSKGERLLMIYFLTRVPSVEYCQMNLV
VVGGLIKQNLVDLHSLRHIVGLTAHDRTSKFIFHPHRSTKPPTVSTQFQTSLGKLMESME
KAEPFFIFCLRSNNGKKDLHFDAELVLQQIKYQGLLQMVRLKKSGFSAKYTFKEFVEQFR
MLLPKGATMRPEHITELFEKMKLDRTNYQIGKTKVFLKEKARQLLQDKYNKEVMHHIIVL
QRWFRASLLRMHFLQKKDATMLIQRNWREFYENQNRAATVIQTAWKSSLKKSKHQREKES
NGSENRLGRDSLTKKELTRQQKVELSPNRTQQRSGSREKREGRGSPPPLTRPLSLPLDPK
AKEEPCPGPPKASSLQRYTDVEAFKEKAEKWRERLSEGERTDESSPEVQRRHGVRKNEFQ
QRRHKGKSVSVDELSKVSSSGSDSSPSTNEPNLLLLVHTSYIRSKCPGQQSLLALPFQST
IVTSGQGSCPQAAQTQAALSLRAQRPDDELWGLQGERLLELSAASHQPQYSQHEETDRRL
HCSVLVSALQPSTAGKKKTLYLKCKKGTQSNVPLIFTVQKKSELYCRFITNLIKVSIPLQ
IPAETDGSSFSCQSRSCDEDLGPHGSNNSQLTTPEKIWFLSKFLRKRPKYPPVNDCPSSK
AALTLANYTPQPYNRPTQETERVGRNPTIRISRATRALQCNTSLEREITDPNELRKLDEF
LGNQVNELQSRMKKLSPTESVFLTATMQFRETIKGMYSVQQQKPQIGYKDLMKGYENQVN
TLAGSKDKKTEVSLVVNLFQSMLDGFIRGELKRVESEPVKATKATKNRRKKAACPNSPLD
HLFSTYQVNIMQSCDLCGSYIWGMEKAYMCSACKLICHKNCLNKIITDCSTRCDRKDDSV
PGSLHFGVQVCVLTSKANPVPKVVELLLIHVELNGLYTEGIYRKSGSTCRARELHQILET
VLDPDGPCLDNYSIHTVTGLVKRWLRELPDPLMTFSLYSDFLHAVELPEKAERIRAIYQK
VEELPPANYSTLERLIFHLVRVAKEEEHNKMSPSSLAIVFAPCVLRSPDVNDPFLGMKDV
SKTTMCVEILISEQFRRYNEKMQNIQQLEYAEALAVSQLKLRRQNTGYSFRTLFEESSIE
PKYPPFFPLNDAVQLIEKPSELDVADHSDELERTLIDRIKSIKQEKVDLACGLPDLEREQ
SDNDNLDSLSLMSSDSL
Download sequence
Identical sequences G3PXL4
ENSGACP00000022353 69293.ENSGACP00000022353 ENSGACP00000022353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]