SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022355 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022355
Domain Number 1 Region: 530-618
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-18
Family Third domain of FERM 0.0047
Further Details:      
 
Domain Number 2 Region: 341-439
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-17
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 3 Region: 237-289
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000824
Family Second domain of FERM 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022355
Domain Number - Region: 481-529
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00109
Family Second domain of FERM 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022355   Gene: ENSGACG00000016924   Transcript: ENSGACT00000022397
Sequence length 643
Comment pep:known_by_projection group:BROADS1:groupIV:5166102:5217863:1 gene:ENSGACG00000016924 transcript:ENSGACT00000022397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASWDLAVTVEDLGSDAPAVTLSVASDLHVGGVILKLVEKTQIKRDWSDHAIWWEQKQQW
LLRTAWTLEKYGIHADARLLFMPQHKPLKLGLPNGKTLRLKACFSRPVFQTVMGICKILD
IRHPEELSLLRPIEEKKKKKDKDSAEEIYDLTEVPLSSASRPLLYDGMPAHFADSPEMEA
VYKMLSVTQPPPAPEVIAKQYRPASVVDKAHINGRWLDSSRCLMQQGIQENDRVWLRFKY
FSFYDMDPKYDVVRLTQLYEQARWAILLEDIDCTEEEMMLFGALQYHISKVSQSEPQMVS
SNAAMDDLDSALQSLEVKLEGESSSASDMLENLTAPDLNDYLKIFRPKRLTLKGYKQYWF
KFQDTSISYFKSKEESIGEPIQQINLKGCEVAPDVNVTAQKFLIRLLIPAPEGMNEVYLR
CENEEQYAQWMAGCRLASKGKTLADSSFQNEIQSIRSFLAMQKKSSHGNAPTNDESINTH
SLVSPRYHKKYKAKQLTPRILDAYQNVAQLSLTDAVMRFLQIWQALPDFGLSYVVVRFKG
SRKDEVLGIAPNRLIRIDLAVGDVVKTWRYNNMKQWNVNWDIRQMAIEFEGNINIAFGCV
TADCKIVHEFIGGYIFMSTRSRAKSDTLNEELFHKLTGGHEAL
Download sequence
Identical sequences G3PXL6
ENSGACP00000022355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]