SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022357 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022357
Domain Number 1 Region: 578-666
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-18
Family Third domain of FERM 0.0047
Further Details:      
 
Domain Number 2 Region: 380-478
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-17
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 
Domain Number 3 Region: 276-328
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000106
Family Second domain of FERM 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022357
Domain Number - Region: 497-577
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00536
Family Second domain of FERM 0.0098
Further Details:      
 
Domain Number - Region: 25-101
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0863
Family First domain of FERM 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022357   Gene: ENSGACG00000016924   Transcript: ENSGACT00000022399
Sequence length 691
Comment pep:known_by_projection group:BROADS1:groupIV:5166573:5217848:1 gene:ENSGACG00000016924 transcript:ENSGACT00000022399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLGRVRKAEVCFTDDSMASWDLAVTVEDLGSDAPAVTLSVASDLHVGGVILKLVEKTQI
KRDWSDHAIWWEQKQQWLLRTAWTLEKYGIHADARLLFMPQHKPLKLGLPNGKTLRLKAC
FSRPVFQTVMGICKILDIRHPEELSLLRPIEEKKKKKDKDSAEEIYDLTEVPLSSGTLTT
PHSHTAYLTCTIHPKFSSDCYHNQDGMPAHFADSPEMEAVYKMLSVTQPPPAPEVIAKQY
RPASVVDKAHINGRWLDSSRCLMQQGIQENDRVWLRFKYFSFYDMDPRYDVVRLTQLYEQ
ARWAILLEDIDCTEEEMMLFGALQYHISKVSQSEPQMVSSNAAMDDLDSALQSLEVKLEG
ESSSASDMLENLTAPDLNDYLKIFRPKRLTLKGYKQYWFKFQDTSISYFKSKEESIGEPI
QQINLKGCEVAPDVNVTAQKFLIRLLIPAPEGMNEVYLRCENEEQYAQWMAGCRLASKGK
TLADSSFQNEIQSIRSFLAMQKKSSHGNAPTNDESINTHSLVSPRYHKKYKAKQQKCHGK
NSKLTPRILDAYQNVAQLSLTDAVMRFLQIWQALPDFGLSYVVVRFKGSRKDEVLGIAPN
RLIRIDLAVGDVVKTWRYNNMKQWNVNWDIRQMAIEFEGNINIAFGCVTADCKIVHEFIG
GYIFMSTRSRAKSDTLNEELFHKLTGGHEAL
Download sequence
Identical sequences G3PXL8
69293.ENSGACP00000022357 ENSGACP00000022357 ENSGACP00000022357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]