SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022375 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022375
Domain Number 1 Region: 51-287
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-51
Family DBL homology domain (DH-domain) 0.0000397
Further Details:      
 
Domain Number 2 Region: 286-421
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-31
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022375   Gene: ENSGACG00000016935   Transcript: ENSGACT00000022417
Sequence length 908
Comment pep:known_by_projection group:BROADS1:groupIII:12408089:12417412:1 gene:ENSGACG00000016935 transcript:ENSGACT00000022417 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEVEGPRLRNVPEDAVSLAYSSNEPIDLEDSHYVALRAALEADLQNLEAQTWGVSVDQN
YRMALTKEAVKRQEVIYELIQTEMHHVRTLKILLYVYGHELKQSSLIEETRLEELFLVVE
ELLNCHQHFLDCLKLLKHQSHEEGSPHNYQITQLGNALIPQFSGALGERMMNLYSVFCSS
HTEAVNLYKEQLQNNKKMQILIKKVGQLPLVRRLGVPECFLLVTQRITKYPILVERIIQN
TEADTDEYRSLVQGLALIKDTISQVNAKVSEYERAARLREIALRLEQKSQGRLKNGVLLR
REDLIQGNRTLMHEGPLTWKSSGRQKAGNATKHTEIHAVLLSDMLLLLQEKDQKLVFAAV
ENKPPVISLQRLIVREVAHEDKAMYLISECNTSMPEMYEIHTRSREECISWMARIRQAVN
CYSEEEVYLQLTTRLQQFQANLRMRDELIMQSLTEKQQLFAALYETITEQETPHKGLLLR
GDTSDLQQGTTLLKGAIYEVENLQSILFTRIKDPDLLLGDSKTQEELLWEAETIGGADGN
PADTNPQNKTHTTNEDASGSEDVPITSDPQLQESPGSDSPEQSADDKVDAKTPNGKFTSS
HCSEAERLYSLEAIVTQQDSQIELLQTFQTKSKQPARHYSSMLLEQEKQRNSEKQKEQLA
NLHKLQAQHREEQQRWEKEKEEHRVEIESLQARLQQREEDCQQWERKLAVEKEELEELKK
GYQEDLERLRESTKSVDRDKERLNQERERLEQLQEKIKKIYPGNSKQFLSSFPPVQDSLQ
SPDFQGDSLEIPPKVPPRRQSICPPQAKTELPAHLISTTNKAQKPAVSVQQQIPTKLAVQ
SKEKGHKSRKSHSRTLSAASIDVSQVLPIRVTGKEGGSLRSLRITQPGAFTPPVSAHSVK
TSQSFSTY
Download sequence
Identical sequences G3PXN6
ENSGACP00000022375 69293.ENSGACP00000022375 ENSGACP00000022375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]