SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022397 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022397
Domain Number 1 Region: 381-567
Classification Level Classification E-value
Superfamily NTF2-like 1.17e-55
Family NTF2-like 0.000000312
Further Details:      
 
Domain Number 2 Region: 119-208
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-31
Family Non-canonical RBD domain 0.00028
Further Details:      
 
Domain Number 3 Region: 214-368
Classification Level Classification E-value
Superfamily L domain-like 4.76e-30
Family mRNA export factor tap 0.0000023
Further Details:      
 
Domain Number 4 Region: 564-632
Classification Level Classification E-value
Superfamily UBA-like 2.81e-24
Family TAP-C domain-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022397   Gene: ENSGACG00000016934   Transcript: ENSGACT00000022439
Sequence length 632
Comment pep:known_by_projection group:BROADS1:groupIV:5239852:5249268:1 gene:ENSGACG00000016934 transcript:ENSGACT00000022439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSGHYYSEHDDRTAPQFRNRKGRGSHKGRSYDRSRRDRQRGGHSVGFGGPGPRSRLDD
IDADVTMSDSSQDNSSQHRFNPYGRPFRKGGDGRFDRDRRQGKGGGGGRGGGFRGGAGNG
GGGRSRSGWFKVTIPHGKKYDKKWLLPALQNICTVPYTPVQYHVEHNRVHFYVDESAVAT
ALHKCSHKITDTDGYKVEVHVNPSAPPSFLITELKPEHLEHLRQCMAKRFDGSQQALDLN
NIRTDPDLVSQNIEVILNRKTNMEAVIKIIEENIPELTGLNLSNNRIHKLDELTDLVSKA
PNLKTLNLSHNELKSDRELDKIKGLKLVELWLNRNPLCDFFKDQASYISSAVRQRFPRLL
KLDGHDLPAPIGFDVETPTVIPPCKGSCFGSEEIKVLILRFLAQYYSIYDSGNRQPLLDA
YHDGASLSLTTPYTTQNPSRSSLGEYHKDTRNLKRIKDTTMRFRLLKHTRLNVVAFINEL
PKTQHDIASFNVDVNTFTNTLLSFTVSGVFKEVAVDGKSRESTMAFSRVFVTVPAGNSGL
CIVNDQLFIRMATTEEIRRAFVAPAPTPSSSPVPTLTAPQQEMLTAFSQKSGMNLEWSQK
CLQDNEWDFNRAAQVFTQLKTDGKIPDVAFIK
Download sequence
Identical sequences G3PXQ8
69293.ENSGACP00000022397 ENSGACP00000022397 ENSGACP00000022397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]