SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022412 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022412
Domain Number 1 Region: 245-565
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-89
Family Protein kinases, catalytic subunit 0.0000000586
Further Details:      
 
Domain Number 2 Region: 16-101
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.21e-26
Family PB1 domain 0.00000719
Further Details:      
 
Domain Number 3 Region: 117-188
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022412   Gene: ENSGACG00000016956   Transcript: ENSGACT00000022454
Sequence length 588
Comment pep:known_by_projection group:BROADS1:groupIII:12445195:12466785:1 gene:ENSGACG00000016956 transcript:ENSGACT00000022454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPTLRDSTMSHPGENSHQVRVKAYYKGDIMITHFEPSISYEGLYGEVKDMCSMDNDQLF
TMKWIDEEGDPCTVSSQLEFEEALRLYELNKDSELIIHVFPCIPEKPGMPCPGEDKSIYR
RGARRWRKLYYACGHAFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLV
TVECGRQMIQEPIMPGGSSSQLDQGEQPGPQNKDSRESLTYDGEEKEARSSRDTGKSPSS
LGLADFDLLRVIGRGSYAKVLLVQLKKTERIYAMKVVKKELVNDDEDIDWVQTEKHVFEQ
ASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNY
LHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGE
DYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVK
AASVLKGFLNKDPKERLGCHPQTGFADIMGHPFFRNVDWDLLEQKQVVPPFKPNISGEFG
LDNFDAQFTNEPIQLTPDDDDVVKKIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences G3PXS3
ENSGACP00000022412 69293.ENSGACP00000022412 ENSGACP00000022412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]