SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022462 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022462
Domain Number 1 Region: 144-694,864-1053
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.8e-213
Family Motor proteins 0.0000000253
Further Details:      
 
Domain Number 2 Region: 2092-2281
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000732
Further Details:      
 
Domain Number 3 Region: 15-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000227
Family Ras-binding domain, RBD 0.0079
Further Details:      
 
Domain Number 4 Region: 2027-2085
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000108
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022462
Domain Number - Region: 1107-1152
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000292
Family Motor proteins 0.038
Further Details:      
 
Domain Number - Region: 1065-1104
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00531
Family Motor proteins 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022462   Gene: ENSGACG00000017000   Transcript: ENSGACT00000022504
Sequence length 2599
Comment pep:known_by_projection group:BROADS1:groupII:19349048:19401226:1 gene:ENSGACG00000017000 transcript:ENSGACT00000022504 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLGRRPRFENSEFTVRIYPGALAEGTIYCPISARKTTTAAEAIERVIERLQLDRARCY
VLAEVKEFGGEEWVLNPSDCPVQRMMLWPRVALEHRPLSGGEDYRFLLRQKNLDGSIHYG
GSLQMWLQVTEERRRMTERGLLPQPDSRGDHADLCHLPELNERSLLDNLRSRFRQEKIYT
YVGSILIVINPFKFLPIYNPKYVKMYDNHALGNLEPHIYAVADVAYHAMLQKESNQCIVI
SGESGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFG
KFIQVNYQESGTVRGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASDEEREAFHLMK
PEEYHYLSQMTKSTQQLRWDSNCESEADCFTVEGEDLKHDFERLQLAMEMVGFLPSTRKK
IFCLLSAILHLGNIRYKKKAYRDDSIDICNPEVLPVVSELLEVKEEMLFEALTTRKTVTV
GERLIVPYKLSEAGTVRDSMAKSLYSALFDWIVFRINHALLNIRDLEETTKILSIGVLDI
FGFEDYEIFKLEQYNHAISYSQYRQRHRMAYRVAVIVSEEYRAEGISWRNIDYIDNTGCI
NLISKKPTALFHLLDEECNLDTESNSSHFEKLESTESSAVQFPPVPNAPGASFFPSSLSK
SPSQDFREKNTDHMRPDIVALLKSSKNAFICGLMGIDPSATFRWAVLRAYFRALVAFREA
GKRHTQKKTGHDDAAPCAVLKSVDSFSFLQHPVHQRSLEILQRCKEEKHSVSRKSPRTPL
SDLQGSNTVNEKSPRSSPSLGWNGRPGRRSRSPAEEDGIFVNSASSKLLERAHDILMRNK
TYKSKPVLPKHLLNVKSLKYLSNLTLHDRITKSLLHLHKKKKPPSISAQFQASLNKLMET
LGQSEPYFVKCIRSNADKLPLRFNDDLVLRQLRYTGMLETVRIRLSGYNIKYSFKDFIHH
FSVLLPERARATRDGIQQSLDQLDLQADGYQVGKTMVFLREAERQRLQAVLHAEVLRRIV
ALQRRFRALLERKQFVRMREAATCIQKWWRLCRPTEDYGPGVQEGAALCLQTHWRGFRER
HRLRLWREAALVLQRAWRSWLCRRGTAATVIQTAWRCHQARDAYLRLYAAVTQLQATGRG
FLARRSFEQLREQRLREETERQETLLARQNGRLRPSPEEEPTERVMGLDLSTWEDRSDEQ
RERSLQIPSSHEGAVDEEGGGEDAGAGEGPPGESSDPIQTSTVVVRERPRTLEEPSQKTT
RAKRESRRMRELEHAKFSLELLKVRATGGGASSPSEERRWSVELVAPATPPPRSPQGTPD
SQSSKGSFELLSMDDEAPRAVEEVTDSEDLCSPVASAAPVPEPGAEEAPSSPRGTDALAE
RGRRRDPTAASRTRIENHLPTFYVPAGQGGAAVSPRPAGEPERNTEAAASRDPADVPELV
KERRESPRQPVVVIISMQKESPMSPETDQFLIEKLVRLNEEKEARQRNLQQQNEKEMMEK
ITQSERDLFEKKREEALQKIQQSRRRAGEDVGSPGERRRPSSLLIERAAGLAPHPRTHSE
STVPPARSRPGETQPQLPPPPASVPRERRKGSGPAAEGWAPKLTLQSKERGGIRARAAAR
KTPSDQGPTVGLKEKEFRSINRLNTKYENKSQNRFDSEAASKLTPAAIPREAPPPVSKPC
KGAKTRDVGRAGQKKKVRMARTRSDFLTRAPSLSVGGDSDEADYEDDGVPRHSSLAFPKP
SAADAGLMKSCFSDSEMVTGADTTSEEQQKIHKAMSSGDLVKVDSMRKNSHDGSLARARR
LRFWTKPKYGEKKTSREKLICGADCAQTPPPSHTAGQENTSPPCSPGSMPDRGFRDLKEN
KEPSPKVKRRRSVKISSAGLEPAQWQNDALQILTCTNDYRSMNDFLMKKINDLDNEDSKK
DTMVDVVFKKALREFRLNIFNSYSTALAMDDGKSIRYKDLHALFEDILEKTMRQEQRNWR
ESPVTVWVNTFKVFLDEFMTEYKPLDSTPSKQVPKPERKKRRKKDPDIVEEHNGHIFKST
QYSIPTYCEYCSSLIWMMDRACVCKLCRFACHRKCCQKTTNKCSKKFDPELSSRQFGVEV
SRLTNDERTVPLVVEKLINYIEMHGLYTEGIYRKPGSTNKIKELKQGLDTDVDSMNLDDY
NIHVIASVFKQWLRDLPNPLMTFELYEEFIRAMALRDKKETVRGVYSVVDQLSRTHLNTL
ERLIFHLVRIALQEDTNRMSANALAIVFAPCILRCPDTIDPMQSVQDIGKTTACVELIIC
EQMNKYKIRLKDINSLEFAENKAKLRLTIIRRSMKPVLIAVRFMSTMTHAAKKGRGRVPR
ASYHTPSPPVSPRLPSVAEPLIEKSGSEGDDSFAEISEHQQAAMRQEERVLTEQIESLQK
EKEELTYEILALEPRASDDETLESEASIGTADSSENLNVDSEPRKSDMTRSDTTRSDMTS
PRRRTVRRQPDSLDSVDSCSSVSSYSSSSHFQPSSSSPSASARRFHFPSKSPPSSLAQAQ
PASASQASRADNTADQEGANDERPQFTSRGTFNPEKGKQKLKGAKHSTLRHSRDGTGHRR
DPPDMPQPLVLYGSNEFMV
Download sequence
Identical sequences G3PXX3
ENSGACP00000022462 ENSGACP00000022462 69293.ENSGACP00000022462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]