SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022597 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022597
Domain Number 1 Region: 73-207
Classification Level Classification E-value
Superfamily BAG domain 8.24e-50
Family BAG domain 0.00000913
Further Details:      
 
Domain Number 2 Region: 2-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000898
Family Ubiquitin-related 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022597   Gene: ENSGACG00000017104   Transcript: ENSGACT00000022640
Sequence length 207
Comment pep:known_by_projection group:BROADS1:groupIII:12947094:12948867:-1 gene:ENSGACG00000017104 transcript:ENSGACT00000022640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTQTITVTVAYGSTKHSITLTGEDDVKGPIVKDLSDALTKATGVPQTSQKLIFKGKSLK
DVEESLSSVGIKEGCKLMLIGKRNSPEEETELKKLKDIEKSVEQTAKKLEKVDGELTGLK
NGFLAKDLQAEALGKLDHRVKIAAEQFMKILEQIDAMSIPENYNDCKMKKKGLVKTVQDF
LAQCDKIEACISDHLSKIQSKNLALAE
Download sequence
Identical sequences G3PYA7
ENSGACP00000022597 69293.ENSGACP00000022597 ENSGACP00000022597

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]