SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022600 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022600
Domain Number 1 Region: 166-343
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-38
Family Phosphotyrosine-binding domain (PTB) 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022600
Domain Number - Region: 136-172
Classification Level Classification E-value
Superfamily SH3-domain 0.000713
Family SH3-domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022600   Gene: ENSGACG00000017110   Transcript: ENSGACT00000022643
Sequence length 355
Comment pep:known_by_projection group:BROADS1:groupII:20427081:20430726:-1 gene:ENSGACG00000017110 transcript:ENSGACT00000022643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGVGGGRDQLRTSMTSEASGLSYDSVKYTLVVDEHAQLELVSLRQCYQGYSDDSDSATVY
DNCVSSPYESAVGEEYEEGVRREATACLSEDSTPEGDLRFSKKFLNVFMNGRSRSSSAES
FGLCSCLINGEERDQSHRAVYRFVPRHDDELELEVDDPLLVEVQSEDYWYEGYNMRSGAR
GIFPAYYAVEVTKDAETSKGAVKSSEWMDGYRLKFLGSVQVPSHKGNDVLCAAMQKIATN
RRMTVKYNPPSSCILEISVKGIKLAVHEDYYARDKSNECSHFFQLKNISFCGYHPKNCKY
FGFITKHPADQRFACHVFVSEDSTKPLAESVGKAFQLYYKEFVEFSCPTEDIYLE
Download sequence
Identical sequences G3PYB0
ENSGACP00000022600 ENSGACP00000022600 69293.ENSGACP00000022600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]