SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022647 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022647
Domain Number 1 Region: 345-740
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.16e-117
Family Oxysterol-binding protein 0.001
Further Details:      
 
Domain Number 2 Region: 23-118
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-24
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022647
Domain Number - Region: 211-261
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0577
Family DNA-binding N-terminal domain of transcription activators 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022647   Gene: ENSGACG00000017144   Transcript: ENSGACT00000022690
Sequence length 740
Comment pep:known_by_projection group:BROADS1:groupXIV:6886543:6896346:1 gene:ENSGACG00000017144 transcript:ENSGACT00000022690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNELVRTLPSPTLPGLQLPCLNTGNYKGWLYKWTNYLKGYQRRWFVLSNGLLSYYRTQAE
MAHTCRGTIPLATAHIEVGDTCHLVLTSGGRSYHLKATSEGECQRWVSALQQARANSTLL
MHHSACEDDSGDEGPIPQEDRALTQGVLKTLASKLDDLSTCNELIGKHGAALQRSLSELE
ELRGSADGTDRVKAVNERATLFRITSNAMINACRDFLDVAESHGRKWQKTLQYEREQRHH
LEETIEQLAKQHNNLERAWRENPTSYTGVERSQEGDASDENDEAEFFDAMEDSPAFITVT
ASGAIQHKRSGSNQSMMSGGMSNDWTHNENVGPERARRSRIPDKPNYSLNLWSIMKNCIG
KDLSKIPMPVNFNEPLSMLQRLTEDLEYSELLDRASRCHSSLEQMCLVAAFSVSSYSTTV
HRTAKPFNPLLGETYELDRLEEYGYRSISEQVSHHPPAAAHHVTSQRGWTLWQHITIDSK
FRGKYISVVPLGNIHLVFHASGNHYVWSKVTSTVHNIIVGKLWIDQSGDIDIVNNTTKDT
CRLKFCPYSYFSRDVPRKVTGVIEDRDGTAHYILSGTWDDKMESAKIVDSSQGCGGSEGK
QKTVYQTLQPKLLWKKYPLPDNAENMHYFSSLALTLNEQEDGIAPTDSRLRPDQRLMEAG
VWDEANTHKQRLEECQRLERKKREAQASQALEEGQDIESYRPLWFEKRADDTTGESTYVY
RGGYWEAKETQDWSQCPEIF
Download sequence
Identical sequences G3PYF7
ENSGACP00000022647 ENSGACP00000022647 69293.ENSGACP00000022647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]