SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022694 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022694
Domain Number 1 Region: 2151-2451
Classification Level Classification E-value
Superfamily BEACH domain 2.49e-127
Family BEACH domain 0.0000000000494
Further Details:      
 
Domain Number 2 Region: 2561-2811
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.11e-32
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 3 Region: 173-357
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-29
Family Clostridium neurotoxins, the second last domain 0.046
Further Details:      
 
Domain Number 4 Region: 2041-2145
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-24
Family PreBEACH PH-like domain 0.00000977
Further Details:      
 
Domain Number 5 Region: 471-539,635-929
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000000499
Family B56-like 0.078
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022694
Domain Number - Region: 51-150
Classification Level Classification E-value
Superfamily ARM repeat 0.00317
Family Armadillo repeat 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022694   Gene: ENSGACG00000017172   Transcript: ENSGACT00000022737
Sequence length 2826
Comment pep:known_by_projection group:BROADS1:groupIX:6342854:6488704:1 gene:ENSGACG00000017172 transcript:ENSGACT00000022737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEETPGAAGPDGRPGAMALNPAVPIRGIKMKFAVLAGLVEVGEVSNRDIVETVFNLLV
GGQFDLEMNFIIQEPDSIVCMVELLDQCEPTCQAEVWSIFTAILKKSVRNLQACTDVGLI
QQVLRRVQTTDSMIADLLVDMLGVLASYSITVKELKLFFSKLQGEKGQWPRHAVKLLSVL
KYMAHRNGPDSFFSFPGKNAAAIALPPIAKWPYQNGFTFHTWLRMDPLNNINVDKDKPYL
YCFRTSKGMGYSAHFVGGCLIVTSLKTKGKGFQHCVKYDFKPQKWYMVTLVHVYNRWKNS
EISCFVNGELASFGDIAWFVNTSDTFDKCFLGSSETADANRVFCGQMGAVYLFGEALSAA
QILAIYQLGPGYQGTFKYKAESDLLFAEHHKTLLYDGKLSSSISFAYNPRATDAQLCLES
SPKDNASIFVHSPHALMLQDVKAVVTHSVQSGIHSIGGVQVLFPLFAQLDFCQPSSQELD
TSVCCTLLSFVMELLKNSVAMQEQVLACKGFHVIGYTLEKSSKVHVTRPVLDIVLAFSRY
LSNLQNGILLLKQLCDHILFNPAIWIHAPAKVQQTLYTYLATEFISTVTIYNTIRRVGTV
LQVMHTMKFYYWVVNPQDRSGVVPKGLDGPRPNQREILSLRAFLLLFVKQLIMKDHGVKE
DELQSILNYLLTMHEDDNIMDVLQLLVALMSEHPGPMVHAFDQRNGIRVIYKLLASNSEG
IRVQTLKVMGYFLKYLPPKRKPEVMLSHGLFSLLTERLMLHSGQFTMTTYNVLFEILTEQ
ICTQVIHKQHPDPDSTVKILNPQILKIIAALLKTSPSSPESMEVRKVFLSDMIKLFNNSR
ENRRSLLQCSVWQEWMLSLCFISPQNSEEQKITEMVYAIFRILLYHAIKYEWGGWRVWVD
TLSITHSKVTFEQHKENLSRMFRQYQSQESAGSVSTLRTISGVSDSSETNGPPAEEAAPS
TVIELTVDELSHKSHDSAPSSTAASSPPQAAGGREHAPIAMGNILAGAEEEEEQKLVQET
PKNDLGDDGRETEAAVPQKDDVKEQSEETDQQEPATAASTDENTDGRQTSVSSQAPADDS
KATEEVRDSDATSEANETPVKDDGRSEPIGGESSSSLNEAEIEPPSVPEQGEVDQTSSDA
ATVSTVSDHVHTSDAEDSQGESSYASAAAGEERDVGEEEGDEEDQGLETKTAEENDEKQE
VGTQETAEEQKIARLDVSNVALDTERLELKEASTTETGQDQQAAAAGGSSGQQREGSSTS
APRSTMFRIPEFRWSHMHQRLLADLLFSIETDVQMWRSHSTKTVLDFVNSSENVVFVHNS
IHLISQVVDNLIMACGGILPLLSAATSSSHELENIEPSQGLSVEASVTFLQRLINLVDVL
IFASSLNFTEIEAEKNMSSGGILRQCLRLVCAMAVRNCLECQQVKSCCSSLNRVLKLIYN
AVALQKGHYGTQSPVDAVTGGVSPVTELDRLLQEMDINRLRAVVFRDIEDSKQAQFLALA
VVYFISVLMVSKYRDILEPHNDKRRPQRSQSARSTGTRRLQILSQVLTNPCFTLINSRIR
LEVENGVSLRRYDSGIGDDHTSTAASEADLSSSGATHGPDAISEALSTLSSEVRPSLPAD
SKGKNVKDILRSLVSALPDAAVDPGLLQPAFLGGVGDAARESAQRFRSFDRSVVVAPKKA
GAAPSPGASTAVPAATAASVSGGTPIDSVAVVSSGDASQSASADPAAGGQVPASASLPSV
PPLSPVTQNTAPNMSISERLENALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTS
LVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSHTMKDHLVRVANEAE
FILSRQRAEDIHKHAEFESACAQYAAEKRDEEKMCDHLIRAAKYRDHMTATQLIQKIVNI
LTDKHGAWGSSSKSRPREFWRLDYWEDDLRRRRRFIRNPFGSTHSEATLKGAAEHVFAVI
CCFSQRKVKSASEEDVLKGKQSIRGQALGNQNSESETLLDGDDDTVSSLEEKDLDNLTGP
VNLSTGAQLVAPAAAVRGTLSITASELYFEVDEDEPGFKAIDPKILAYTEGLHGKWLFTE
IRAVFSRRYLLQNTALEIFLANRTAVIFNFPDAATKKVVHSLPRVGVGTNFGLPQTRRIS
LATPKQLFKAFNMTQRWQRREISNFDYLIFLNTISGRTYNDLNQYPVFPWVITNYDSEEL
DLTLPSNFRDLSKPIGALNPKRAAFFSDRYESWEDDQVPKFHYGTHYSTSSFTMMWLLRI
EPYTTFFLNFQGGKFDHADRTFSSVSRAWRNCQRDTSDVKELIPEFYYLPEMFVNANDYN
LGVMEDSAVVSDVELPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEAT
RALNVFYYLTYEGAVNLSSINDPMLREAVESQIRSFGQTPCQLLIEPHPPRSSAMQVTPL
MFTEQMQQDVIMVLKFPSNSPVTHIAANTQPGLTSPAIITVTANRIFAVNKWHGLTGHQS
STTQDQQYQLPVEIDPLIASNVGSHRRQISDLLDQSIQISSQCFVITADNRFILLCGFWD
KSFRVYSTDSGKLTQIVFGHRDVVTSLARSESYIGGDCYVLSGSRDATLLLWYWNGKLNS
IGESPGTEFTTPRAILTGHDCEVTCASVCAELGLVISGCKEGPCLIHSMNGDLLRTLEGP
ERCLRPRLIQASTEGHCVIYYDKGQFCHFSVNGKLLGHMEVEDSIKAMYVSRDGQYLLTG
GDGGVVSVWQVHNLKQLFTYPGCDAGIRSMTMSHDQRCIITGMASGSIVLFYNDFNRWHH
EYQTRY
Download sequence
Identical sequences G3PYK4
ENSGACP00000022694 69293.ENSGACP00000022694 ENSGACP00000022694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]