SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022722 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022722
Domain Number 1 Region: 5-279
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.41e-70
Family BAR domain 0.0012
Further Details:      
 
Domain Number 2 Region: 395-572
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00000173
Further Details:      
 
Domain Number 3 Region: 721-776
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000223
Family SH3-domain 0.00016
Further Details:      
 
Domain Number 4 Region: 264-369
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000166
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022722   Gene: ENSGACG00000017201   Transcript: ENSGACT00000022765
Sequence length 777
Comment pep:known_by_projection group:BROADS1:groupIX:6611973:6651354:-1 gene:ENSGACG00000017201 transcript:ENSGACT00000022765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLHPLEFSECYLDSPSFREKIKSHEAELDKTNRFIKELYKDGKNLINATKQLGMAQRKF
AQCLGEFQFEYIGDAKTDDEKCIDESLQEFSSFLKNLEDQRELMMRNITETLMKPLEKFR
KDQLGTVRKAERKKYEKETEKYYSSLEKLLNMSAKKKEPQLQEADSQVETMKLHFQEESL
TYVCKLQEIQERKKFECVEPMLAFFQTVFTFYHQGFELAKDFDHYKKALQINIQNTRSRF
EGARSEVYDLMKRIREAPQEYRQTSPISCEGYLYVQEKRPPPFGSSWVKRYSTYVTKQKI
LHMVTFDHRSGGKIGETESVTLKSCLRKTLDVLDRRFCLELEITDRPGTVLTVQAMSEDD
HKFWMQAMDGKEAVSQPPAPCFDAQLNNVGLSFMKNAISAIETRGINDQGLYRVVGVSSK
VQKLLSLMIDEESNEVDLSTSEDWDVKTVTSTLKLYLREASPEPLMTLWTLQRVYLPRQG
GSPESRIQAVHCLVHKLPERNRQVLGLLMKHLAKVAAHSKHNLMTVANLGVVFGPTLMRP
QEDTVAAIMDLKFQNIVVEILIEHDEKIFTDAPESCPPSPPAQIASAPTRQSKKQSRQNR
PLAVYNPQALDIHNGKLITRPGDPDSLATAICDPSPRTTPPHPPLHTVADGSSLTADAAT
PGERTATLESQLNAGVLILKQIQSPMNPNQEPPVRLPAPRPRPKLAPPQLPLTRRSQSVT
SRKAKAVYPCEAEHDSELSFQVGAIFNGVTQSREPGWLEGELEGKRGLIPENYVEML
Download sequence
Identical sequences G3PYN2
ENSGACP00000022722 69293.ENSGACP00000022722 ENSGACP00000022722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]