SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022723 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000022723
Domain Number - Region: 3-49
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00429
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number - Region: 190-224
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0502
Family Ubiquitin-related 0.015
Further Details:      
 
Domain Number - Region: 104-160
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.091
Family Ubiquitin-related 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022723   Gene: ENSGACG00000017205   Transcript: ENSGACT00000022766
Sequence length 229
Comment pep:novel group:BROADS1:groupIII:13201209:13203660:-1 gene:ENSGACG00000017205 transcript:ENSGACT00000022766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAIFNILQQFRLESSHSQFMLLGVKDVEDFLDCITDKDLDNIGLTHVEKNRFSSMKNFI
QRLKTMEPQVQPVMPVQRWLFTLQYTYPKCPQPVHIKDMDPAINTVEDLMLTICHLESVG
NSKGVCLYAVDGMPLTDDPFFNTWSLKDRHIENGAVIYAIFTPKENVKRAPQIPKREVGE
PNGDDVVRCHVMLKGDFEVTVNLASDTITSLRLKLANQSGVPTHVLHYK
Download sequence
Identical sequences G3PYN3
ENSGACP00000022723 ENSGACP00000022723 69293.ENSGACP00000022723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]