SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022782 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022782
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-21
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022782   Gene: ENSGACG00000017250   Transcript: ENSGACT00000022825
Sequence length 701
Comment pep:known_by_projection group:BROADS1:groupIX:7131393:7145303:1 gene:ENSGACG00000017250 transcript:ENSGACT00000022825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWKKRWFVLRCGRLTGDPDVLEYYKNDHAKKPIRVIDLNLCEQVDAGLTFNKKDLEHSFI
FDIKTIDRVFYLVADTEEEMNKWVRCICDICGFNPTDDEAAKAAHQSAIGGLVVDTAPHP
ALGSIVGPAAMLTSVPPPYQPVKVRHLDSQSSSDEPQDYLWLVNCESKKPEPNRAHGECS
KSTSSETDLNDNLPSHRTPTSTSSAKHTSHNGFFPQHPAPASASSIYDSPPSRCASLSTD
SSLYHLPRSCSQDTVLLPKSASSPVAHPDSGDGSELYVFNTPSRKPSMESQLRNLSISYD
IPPTPGANCTYQVPRTLSASTGTGGSEGGGDAVPPPRPPKPSLGSTSGPPPPPAERSPTD
NYFVPRSASETDGNYCVPTSSGNKALRSNTIGTVDCSRIRKDFGSQDCYDIPRSFPSEKN
CSFDFNENFNMYFKNKGMMPVGSQSTEEVDQNYVPMSANSPSHHHSGSLSEPMHEPNYVP
MTPGTMEFSSLGKQVPPPAHMGFRSSPKTPPRRPMLNDCQPPPVDRNLKPDRKGRPAPLE
IKPLPEWEEPCTPVRSPVTRSFARDLSRFPMPTRPASVHSTASSTDSEDCDENYVAMVSN
KSTDEPNMKLGAPMTADGGSSPMVKAKGDKQVEYLDLDLDSGKSTPPRKVKSNGTGITVS
DERVDYVVVDQQRTQALKSTREAWNDGRQSTETDTPSKGPK
Download sequence
Identical sequences G3PYU2
69293.ENSGACP00000022782 ENSGACP00000022782 ENSGACP00000022782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]