SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022851 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022851
Domain Number 1 Region: 773-996
Classification Level Classification E-value
Superfamily WD40 repeat-like 2e-22
Family WD40-repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022851
Domain Number - Region: 103-162
Classification Level Classification E-value
Superfamily UBA-like 0.000438
Family UBA domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022851   Gene: ENSGACG00000017302   Transcript: ENSGACT00000022894
Sequence length 997
Comment pep:known_by_projection group:BROADS1:groupII:21638823:21646174:-1 gene:ENSGACG00000017302 transcript:ENSGACT00000022894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSLEDTTTATTPVTDTETAPASESPGVMPLSLLRQMFSSYPTTSLAPSRRAQTPPVSS
LPTSPSEEVGRRQSLTSPDSQPSRPQNRTGHLAALSDPSSRLSTSPPPPAIAVPLLEMGF
SLRQITKALEATGARGEADAQNITVLAMWMIEHPGTDDEHDEPHEVVVGGDGSDSSCPGA
MASSGGKSLERSPYLCSPGDIADASEMEEGFSESPEGLDQDASGGGPLRGRSAAGRKHRF
DLAARTLLARAAGLYRSVQAHHSQSRREVASDPGALYDFNLDEELEMDLDEETMEAMFGQ
DLASDTDILGMWIPEVLDWPTWHVCETDDRDEVVVCELCEANVANFNQHMKKSHPGCGRS
ANRQGYRSNGSYVDGWFGGECGSGNPYYLLCGGCREKYLAIKSKAKVPVVERYKGQAPDL
LGKQDSVYEEDWDMLDVDEDEKLTGEEEFELLAGPLGLSERRLVPEAVQFPDSDPLGASV
AMVTASNSMEETLLQIGCQTSVDKSSSGRVTLGEQAAALQNPHDRVMALRRVTAAAQVLL
ARTMVMRALSLLSVSGSSCSLAAGLESLGLTDIRTLVRLMCRLSTSSTSGSGHADRPRGA
AKASKPISSLAYLSTAVGCLASNGPNAAKLLVQLCTQNLISAATGMNLTTVDDPIQRKFL
PSFLRGVAEENKLVTSPNFVVTQALVALLADKGARLRPACDKADTEKRGPLELANALAAC
CLSSRLSSQHRQWAAQQLVRTLAAHDRDNNHTRPQSFADLAGDLRRCSSVKLEAHQSRVI
TCRWCSKKGLLATSGNDGTVRMWNVTKNQYALQQTCIFNKDDGSSEDGTSGLGSPSDPCM
SPLAWSVTGKYLASAMEKLVNIWQVNGGKGLLDVQPHWVSALAWPREEAESLWCGEPRDV
LLVGRMDGSLGLIEVLDSSSMQRTELEHCYRKDAVAVMHIAWYSENKPFAVGYADGKLLI
GSKEPLEKGAVVVIDAHKEAISSMKWSPDGHVLLTCA
Download sequence
Identical sequences G3PZ11
ENSGACP00000022851 69293.ENSGACP00000022851 ENSGACP00000022851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]