SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022893 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022893
Domain Number 1 Region: 75-415
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-84
Family Protein kinases, catalytic subunit 0.00000225
Further Details:      
 
Domain Number 2 Region: 955-1021
Classification Level Classification E-value
Superfamily G protein-binding domain 3.92e-21
Family RhoA-binding domain 0.00044
Further Details:      
 
Domain Number 3 Region: 1237-1297
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000174
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 4 Region: 1130-1218,1302-1329
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000721
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 5 Region: 429-532
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000471
Family Myosin rod fragments 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022893
Domain Number - Region: 1020-1108
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00837
Family Myosin rod fragments 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022893   Gene: ENSGACG00000017327   Transcript: ENSGACT00000022936
Sequence length 1365
Comment pep:known_by_projection group:BROADS1:groupIII:13672383:13693975:1 gene:ENSGACG00000017327 transcript:ENSGACT00000022936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGESMAARFEKIDAMLKNPKSEVNTDCLLDGLDALVYDLDFPALRKNKSIDNFLSRYK
DTISKIRDLRMKAVDYEVVKVIGRGAFGEVQLVRHKATCKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSSWVVQLFFAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDGIHSMGFIHRDVKPDNMLLDKAGHLKLADFGTCMKMNKDGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNALNFP
DDSDISNDAKNLICAFLTDREVRLGRNGFDEIKRHPFFKNDQWTWENIRDTAAPVVPELS
SDVDTSNFDDIEEDRGEEETFPIPKAFVGNQLPFVGFTYYSSQHQLRSSSAPTKTSEKRS
SATKEDKSHLENLQKRIYQLEEQLHSEMQLKDELEQKCRTSNTKMDKIIKELDEEANLRK
SAESSISLLEKDKIMLQHRFTEYQRKADQDAEKRRNLENEVSSLKEQLEDMKKISQNSQA
SNDKMVQLQNQMEEANDLLRAESDTAARLRKSHTEMAKSMSQLESLNRELQERSRAADSE
KAQLEKELLLLQSSLDSERRNYSLGSEEIRELQARMAGLQEDNKSLKLSLSKVESERKQA
QERSNNQEKEKNNLEIDLNYKLKTLQQRLEQEQTEHRVTRAQLTDKYESIEEAKSAATNA
VQQKMSEENVARMRAESRVVEVEKQCSMLEFDLKQSVQKMEQLMKQKERLEDEVMNLQLQ
GEQESSKRVQTQNDLKGRMQEVDRLRCSEKQLKQEINASLESKRSLEFQLAQLTKQYRGN
EGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRQVQETHKRVQELCSERDSLSAQL
DLTVTKAESEQLARALQEEQYFELSQENKKAISRHKQDIGEKEATIARLEESNNTLTKAV
ENLSKEKTDLSEKFSSLEEDYAAEKEEISNTIKSNYEKILNTERTLKTQAVNKLAEIMNR
KDMKLDQKKKGSTADLRKKEKENRKLQLELNQEKEKFNHMAIKYQKELSEMQAQLSEEST
YRNELQMQLDSKESDIEQLREKLNDLQLRMDTSSVTSLQTDETDGNIAESRLEGWLSIPN
RANIKRYGWRKQYVVVSSKKILFYNNEEDKELSNPSMVLDIDKLFHVRPVTQGDVYRAET
EEIPRIFQILYANEGECRKEAEMEAVPQGDKTNCLPHKGHEFIPTLYHFPSNCEACSKPL
WHVFKPPPALECRRCHVKCHKDHLDKKEDLIAPCKVNYDVTSARDMLLLALTQDEQKKWI
GHLGKKIPKTPPSTFSRASPRSMSTRSGPNQSFRKNPKGNTTKLR
Download sequence
Identical sequences G3PZ53
ENSGACP00000022893 ENSGACP00000022893 69293.ENSGACP00000022893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]