SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022920 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022920
Domain Number 1 Region: 349-483
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.56e-34
Family Synaptotagmin-like (S variant) 0.0015
Further Details:      
 
Domain Number 2 Region: 498-632
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.28e-28
Family Synaptotagmin-like (S variant) 0.0022
Further Details:      
 
Domain Number 3 Region: 10-128
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.01e-26
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022920   Gene: ENSGACG00000017349   Transcript: ENSGACT00000022963
Sequence length 672
Comment pep:known_by_projection group:BROADS1:groupIV:6447553:6453008:-1 gene:ENSGACG00000017349 transcript:ENSGACT00000022963 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASDMINLGYLSDSERQLILDVLQRDAELRQAEEQRVRSLKSELLDVKRKGAKRGSGKYSE
RSCGRCLQPLSRLTASSSQCKICNHHVCSKCRTVLPEGSWLCTVCAKESDLKKRTGDWFY
DQRVNRFSAAPGHDLVRASLKRRPQGNKRETTGEILLRSTEVNQDPPVPAPRVRQRDAIT
VNKECVSIKKNNSGSIASRESRESKEEVWSKSTRSDAESAENGGVCTPTWKQTTSPQAPQ
VKPLSWSPAMDVDRLFKKSIKRDTKPAESVSTVDLRDGRDGPEASMGSRSRSVPGLDVQM
FMLPQEGGEEEEDIDRLVTFHKRTMASSSYSLHSSKSTLGSLMSVYSEAGDFDSVEVSGD
LVFSLTYEELSQSLHVFIKECRGLAYGDASKQLSHPYVKCYLLPDKSRQSKRKTSIKRNT
VNPVYEETLKYSIGRTQLFTRSVLISVWHHGRFSRNAFLGEVEVALDTRDLDSPHTDRVI
LMGKAPSAGPSSAFALYKGELVISLKYVTPKTAKTEKVKGKKAAMEGGGELHVLIKEAKN
LIAMKPGGTSDSFVKGYLFPTKAKTTKRKTPVVKKNLNPHYGHTFVYKDLSPEQLERMCL
ELTVWDREAMSSNEFLGGVRLGSKKGAVNAGKVEVQMDSVGEEVSMWEKMMQYPDSWAEG
SLPLRSTMLKGK
Download sequence
Identical sequences G3PZ80
ENSGACP00000022920 69293.ENSGACP00000022920 ENSGACP00000022920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]