SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022928 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022928
Domain Number 1 Region: 100-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.3e-86
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000000000347
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.3e-22
Family Ubiquitin-related 0.0000198
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022928   Gene: ENSGACG00000017336   Transcript: ENSGACT00000022971
Sequence length 474
Comment pep:known_by_projection group:BROADS1:groupIII:13697634:13701642:1 gene:ENSGACG00000017336 transcript:ENSGACT00000022971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFPVNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKDDEWGNIK
LKNGMTLLMMGSAEALPEEPAVRPMFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQC
LRSVPELKTALRRYAGALRSSGANAPSQYITAALRDLYETMEKTSSSLPPIILLQFLHMA
FPQFAEKGDQGQYLQQDANECWLQMMRVLQQKLEPLEPETSMEKNLIDQYFGVEFETTMK
CTESEEEEPVKGKESQLQLSCFINQEVKYLSTGLRLRLQEEITKMSPSLERNALYIKSSK
LSRLPAYLTVQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCTAEVQEKMLPVRSKFKE
VEDKNLEKQQKKLVKKPEAEKVKYEPFSFPDVQEGNLGSNNSGYYDLQAVLTHQGRSSSS
GHYVGWVKRKEDEWVKFDDDKVSLVSPEDILRLSGGGDWHIAYVLLYGPRRLEM
Download sequence
Identical sequences G3PZ88
ENSGACP00000022928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]