SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022935 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022935
Domain Number 1 Region: 86-448
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.34e-81
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000000000756
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000768
Family Ubiquitin-related 0.0000556
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022935   Gene: ENSGACG00000017336   Transcript: ENSGACT00000022978
Sequence length 455
Comment pep:known_by_projection group:BROADS1:groupIII:13697643:13701642:1 gene:ENSGACG00000017336 transcript:ENSGACT00000022978 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNVKWGKEKFDAVELNTEEPPMVFKAQLFALTGVQPDRQKVMVKGGTLKGMTLLMMGSAE
ALPEEPAVRPMFVEDMTEEQLASAMELPCGLTNLGNTCYMNATVQCLRSVPELKTALRRY
AGALRSSGANAPSQYITAALRDLYETMEKTSSSLPPIILLQFLHMAFPQFAEKGDQGQYL
QQDANECWLQMMRVLQQKLEPLEPETSMEVGFFLTPPFSMKCTESEEEEPVKGKESQLQL
SCFINQEVKYLSTGLRLRLQEEITKMSPSLERNALYIKSSKLSRLPAYLTVQMVRFFYKE
KESVNAKVLKDVKFPLMLDVYELCTAEVQEKMLPVRSKFKEVEDKNLEKQQKKLVKKPEA
EKVKYEPFSFPDVQEGNLGSNNSGYYDLQAVLTHQGRSSSSGHYVGWVKRKEDEWVKFDD
DKVSLVSPEDILRLSGGGDWHIAYVLLYGPRRLEM
Download sequence
Identical sequences G3PZ95
ENSGACP00000022935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]