SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022946 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022946
Domain Number 1 Region: 831-1115
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-72
Family Protein kinases, catalytic subunit 0.00000372
Further Details:      
 
Domain Number 2 Region: 528-816
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.25e-46
Family Protein kinases, catalytic subunit 0.0000796
Further Details:      
 
Domain Number 3 Region: 369-497
Classification Level Classification E-value
Superfamily SH2 domain 1.34e-18
Family SH2 domain 0.0027
Further Details:      
 
Domain Number 4 Region: 272-383
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000996
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 5 Region: 146-259
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000146
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022946   Gene: ENSGACG00000017365   Transcript: ENSGACT00000022989
Sequence length 1127
Comment pep:known_by_projection group:BROADS1:groupXIV:7442750:7455890:-1 gene:ENSGACG00000017365 transcript:ENSGACT00000022989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACILLTNMDPPVHGPAAHLHPATGVDSKQDADATCLTVHLYYVGKDGGGGNGSESVLTF
PPGEYVAEELCISAAKACGIAPVYCSMLGLMRESDRIWFPPNHIFKLQQPAREVLHLRVR
YYFTGWYNNGNALNAHRYGVSKGAESPVMDDCIMAYQFLQSRSDFLNGRVDIPVSHEAQE
ECLGMAVLDMMRLAKENAQSPLDIYNSTSYKSFLPRCMQSRIQEYNILTRKRIRYRFRKF
IQQFGECKATVCNLKLKYLMSLEMLLPSLYAERFQVADLSARQVTIVVTGDTGIQWSKGK
EEAGAEEELQTYCDFAEVIDVSIKQANKEGSAESRIVTLTRQDNQILQKELEFQSLAEAL
SFVSLVDGYYRLVADAHHYLCKEVAPPRLLECIQSHCHGPVSMEFTIAKLRRSGNHQGLY
ILRCSPKDYDKYFISFVVGHETMVDYKHCQIVKTESGEHILSGAKRSFDSLRELLHCYQK
EALRTDGYTFQLSRCCSPGLKDKSNLVVCRNNQGADVPLTPSLHKHNISQMVFHKIRKED
LVIKESLGQGTFTKIFCGVRKELGDYGEIHTIDVVIKILDKAHRDYSESFFEAASMMSQL
SHKHLLLNFGVCVCGNENMMVQEYGKFGSLDTYLKKNKSRVNITWKLEVAKQLSWAMHYL
EDKNLVHGNVCAKNVLLIREEDRMTGSLPFIKLSDPGISITVLPREVLVERIPWVPPECI
GKPQNLSLATDKWGFGTTLWEICSGGDKPLSTLDCSKKNLFYEDRHQLPAPKWTELANLI
NSCMDYEPSHRPSFRAIIRDLNSLFTPDYELLVESDMVPNRTRGVGFPWATESQEPAQFE
ERHLIFLKLLGKGNFGSVEMCRYDPLQDSTGEVVAVKKLQQSTAEHLREFEREIEILKSL
QHENIVKYKGVCYSAGRKNMRLIMEYLPFGSLRDYLVKHKERFDLNKLLHYASQICKGMD
YLATKRYIHRDLATRNILVESETRVKIGDFGLTKVLPQDKEYYTVREPGESPIFWYAPES
LTESKFSVASDVWSFGVVLYELFTYTDKNCSPPAVFMDKIGNEKQGQMIVYHLIDLLKQG
YRLPAPDDCPKEVLRIMAECWSSEPGLRPSFKTLFHSVDTVRDSKDR
Download sequence
Identical sequences G3PZA6
ENSGACP00000022946 69293.ENSGACP00000022946 ENSGACP00000022946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]