SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022961 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022961
Domain Number 1 Region: 548-706
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.14e-45
Family Ypt/Rab-GAP domain of gyp1p 0.0081
Further Details:      
 
Domain Number 2 Region: 681-804
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 6.8e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 3 Region: 129-268
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-24
Family Phosphotyrosine-binding domain (PTB) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022961   Gene: ENSGACG00000017370   Transcript: ENSGACT00000023004
Sequence length 1064
Comment pep:known_by_projection group:BROADS1:groupXIV:7492510:7532311:1 gene:ENSGACG00000017370 transcript:ENSGACT00000023004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMDDKGSVGKISVSSDSVSTLNSEDFVLVSRLGDETPSSTNNGSDDEKTGLKIVGNGSEQ
QLQRELEDVLMDPSVADTGLKSETVMENLGALPATASPVPPGSDPLSAQPPKLEMVLPVQ
TAQENGSPGSPIPDEDSVVFSQLTYLGCASVNAPRSEVEALRMMSILRGQCQLPLDVTLS
VPGVSEGTVRLLDPNTSTEIANYPIYKILFCVRGHDGTPESDCFAFTESHYNAEIFRIHV
FRCQIQEAVSRILYSFATAFRRSAKKILLSSQQPAPLTPDSDLFTFTVSQEIKEDDGKGT
FSAVVKDKDKQSFKLRAGMDKKIVIYIQQTSNKELAIERCFGLLLSPGKNVKNSDMHLLD
LLRESMEKSSDGKSYIITGSWNPNTPQFQPVNEETPKDKFMYMTTAIDLVITEVEEPVRF
LLETRVRVCSPNDRLFWPFSKRNYTETFYLRLRQMERKERKSPASDTLYEVVSLESETER
EKRKTTASPGIMPTRTGTTVPSPPEDDEEEDNDEPLLSGSGDVSKECAEKILETWGDLLS
KWHLNLSVRPRQLPALVRSGIPEALRGEVWQLLAGCHNNDHQVEEYRTLITKESPQDSAI
TRDINRTFPAHDYFKDTGGDGQDSLYKICKAYSVYDEEIGYCQGQSFLAAVLLLHMPEEQ
AFSVLVKIMFDYGLRDLFKQNFEDLHCKFFQLERLMQEYIPDLYNHFLNVGLEAHMYASQ
WFLTLFTAKFPLYMVFHIIDLLLCEGISVIFNVALALLKTSKDDLINTDFEGALKFFRVP
VPKRYRSEENAKKLMELACSIKISQKKLKKFEKEYHTLREQQEQQEAPIERYERENRRLQ
DANMRLEQENDDLAHELVSSKIALRRDLDNAEEKADALNKELLLTKQKLVDSEDEKRRLE
EESAQLKEMCRRELDKSESEIKKNGSIIGEYKQICSQLSERLEKQQTANRGELEKIRSKV
EGCEKCSGLFNKEGRVRAAVSRATAGGAEETDEEKEDLKNQLREMELELAQTKLQLVEAE
CKIQDLEHHLGLAFNEVQAAKKTWFNRTLSSIKTVTGAQGKETT
Download sequence
Identical sequences G3PZC1
69293.ENSGACP00000022961 ENSGACP00000022961 ENSGACP00000022961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]