SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022976 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022976
Domain Number 1 Region: 26-142
Classification Level Classification E-value
Superfamily SH2 domain 1.14e-23
Family SH2 domain 0.00079
Further Details:      
 
Domain Number 2 Region: 365-578,605-663
Classification Level Classification E-value
Superfamily Ras GEF 4.97e-23
Family Ras GEF 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022976   Gene: ENSGACG00000017388   Transcript: ENSGACT00000023019
Sequence length 668
Comment pep:known_by_projection group:BROADS1:groupXIV:7651922:7659770:1 gene:ENSGACG00000017388 transcript:ENSGACT00000023019 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSTQFSKEKYLLESPPEKLRKELEEELKLSAADIRSHGWYHGHIPREVSETLVVRNGDFL
VRDSLAGVGDYVLTCRWDNEVLHFKISKVLVRTVDAFTQVQYVLEADSFDSVQELVRFYI
GQRKPVSQSSGVHIYCPVSRTLPLRYLEATFALAASKQSSAYSPSSQRGAYIKRRSVTMN
DGLTMDKMISHRCCVFSPSTIHHHKDAMRNCAMSMDQIQEYRRPLSPVGETPRSPAYSAT
VTRQRAHSSGRVLAVVPPSPQMRRSSDPELSPPAGNNPAEHPAHTSHPPHSAPARHPGHQ
THSSETAGSYCDLRPCPAGPPKPPNKSYVERLRVEDGRADGARVEGEGVFSAPQVETASS
FRPSRYASCLMPADNKPLEMSVLKRVKELLAEVDARTAAVHITMADCTVARILGVTTELQ
RMMGVSSGLELLTLPHGHQLRLDLLERFYTMSIMMAVDLLGCTGSTEERAALLHKTIQLA
AELKSNLGNMFGFAAVMRALELPQISRLEQTWVTLRQRHTEGAILYEKKLKPFMKNMNDG
KESNALANTSVPHIIPILSLLERGMAVGEALEPWESAEVGVDVVMYHLEAARTMAHHGGI
YRSNTETKLQGFQERAEIHEIFQTEFQMRLLWGSRGSEGSQSERYEKFDKVLTALSYKLE
PPVRHSEL
Download sequence
Identical sequences G3PZD6
ENSGACP00000022976 ENSGACP00000022976 69293.ENSGACP00000022976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]