SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023080 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023080
Domain Number 1 Region: 513-613,4362-4459
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-37
Family Fibronectin type III 0.00055
Further Details:      
 
Domain Number 2 Region: 5663-5782
Classification Level Classification E-value
Superfamily PH domain-like 1.31e-33
Family Pleckstrin-homology domain (PH domain) 0.00085
Further Details:      
 
Domain Number 3 Region: 5459-5660
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-27
Family DBL homology domain (DH-domain) 0.00069
Further Details:      
 
Domain Number 4 Region: 5786-5885
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-23
Family I set domains 0.0063
Further Details:      
 
Domain Number 5 Region: 10-102
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-22
Family I set domains 0.009
Further Details:      
 
Domain Number 6 Region: 4914-5006
Classification Level Classification E-value
Superfamily Immunoglobulin 4.12e-22
Family I set domains 0.0066
Further Details:      
 
Domain Number 7 Region: 108-199
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-20
Family I set domains 0.0076
Further Details:      
 
Domain Number 8 Region: 245-333
Classification Level Classification E-value
Superfamily Immunoglobulin 2.51e-20
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 3883-3976
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-19
Family I set domains 0.028
Further Details:      
 
Domain Number 10 Region: 3615-3708
Classification Level Classification E-value
Superfamily Immunoglobulin 2.4e-19
Family I set domains 0.0095
Further Details:      
 
Domain Number 11 Region: 5876-5971
Classification Level Classification E-value
Superfamily Immunoglobulin 2.68e-19
Family I set domains 0.0086
Further Details:      
 
Domain Number 12 Region: 4685-4775
Classification Level Classification E-value
Superfamily Immunoglobulin 1e-18
Family I set domains 0.0058
Further Details:      
 
Domain Number 13 Region: 5153-5252
Classification Level Classification E-value
Superfamily Immunoglobulin 2.55e-18
Family I set domains 0.012
Further Details:      
 
Domain Number 14 Region: 3090-3176
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-18
Family I set domains 0.065
Further Details:      
 
Domain Number 15 Region: 3793-3887
Classification Level Classification E-value
Superfamily Immunoglobulin 2.54e-17
Family I set domains 0.031
Further Details:      
 
Domain Number 16 Region: 5050-5147
Classification Level Classification E-value
Superfamily Immunoglobulin 3.18e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 17 Region: 3347-3440
Classification Level Classification E-value
Superfamily Immunoglobulin 4.26e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 18 Region: 3175-3262
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 19 Region: 2159-2248
Classification Level Classification E-value
Superfamily Immunoglobulin 2.11e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 20 Region: 2639-2732
Classification Level Classification E-value
Superfamily Immunoglobulin 3.94e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 21 Region: 2461-2555
Classification Level Classification E-value
Superfamily Immunoglobulin 5.24e-16
Family I set domains 0.016
Further Details:      
 
Domain Number 22 Region: 1809-1891
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000113
Family I set domains 0.017
Further Details:      
 
Domain Number 23 Region: 4092-4185
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000129
Family I set domains 0.029
Further Details:      
 
Domain Number 24 Region: 2842-2927
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000214
Family I set domains 0.011
Further Details:      
 
Domain Number 25 Region: 326-419
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000243
Family I set domains 0.016
Further Details:      
 
Domain Number 26 Region: 3264-3350
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000027
Family I set domains 0.086
Further Details:      
 
Domain Number 27 Region: 1543-1624
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000351
Family I set domains 0.032
Further Details:      
 
Domain Number 28 Region: 3452-3530
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000399
Family I set domains 0.017
Further Details:      
 
Domain Number 29 Region: 3535-3625
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000552
Family I set domains 0.016
Further Details:      
 
Domain Number 30 Region: 1357-1436
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000001
Family I set domains 0.06
Further Details:      
 
Domain Number 31 Region: 972-1067
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000113
Family I set domains 0.026
Further Details:      
 
Domain Number 32 Region: 2282-2375
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000115
Family I set domains 0.011
Further Details:      
 
Domain Number 33 Region: 1082-1163
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000267
Family I set domains 0.025
Further Details:      
 
Domain Number 34 Region: 1637-1713
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000308
Family I set domains 0.029
Further Details:      
 
Domain Number 35 Region: 1451-1532
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000534
Family I set domains 0.023
Further Details:      
 
Domain Number 36 Region: 1901-1987
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000592
Family I set domains 0.013
Further Details:      
 
Domain Number 37 Region: 898-978
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000593
Family I set domains 0.042
Further Details:      
 
Domain Number 38 Region: 1266-1347
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000139
Family I set domains 0.037
Further Details:      
 
Domain Number 39 Region: 2930-3015
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000154
Family I set domains 0.035
Further Details:      
 
Domain Number 40 Region: 694-778
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000172
Family I set domains 0.022
Further Details:      
 
Domain Number 41 Region: 1174-1255
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000323
Family I set domains 0.04
Further Details:      
 
Domain Number 42 Region: 4011-4099
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000377
Family I set domains 0.017
Further Details:      
 
Domain Number 43 Region: 1984-2072
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000642
Family I set domains 0.012
Further Details:      
 
Domain Number 44 Region: 788-876
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000107
Family I set domains 0.029
Further Details:      
 
Domain Number 45 Region: 1727-1805
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000116
Family I set domains 0.013
Further Details:      
 
Domain Number 46 Region: 2738-2821
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000627
Family I set domains 0.031
Further Details:      
 
Domain Number 47 Region: 430-507
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000066
Family I set domains 0.019
Further Details:      
 
Domain Number 48 Region: 2552-2643
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000914
Family I set domains 0.034
Further Details:      
 
Domain Number 49 Region: 2080-2171
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000226
Family I set domains 0.0059
Further Details:      
 
Domain Number 50 Region: 3713-3801
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000194
Family I set domains 0.0095
Further Details:      
 
Domain Number 51 Region: 5377-5440
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000328
Family SH3-domain 0.0038
Further Details:      
 
Domain Number 52 Region: 4181-4277
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000623
Family I set domains 0.0077
Further Details:      
 
Domain Number 53 Region: 2381-2474
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000879
Family I set domains 0.0052
Further Details:      
 
Domain Number 54 Region: 4283-4345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000515
Family I set domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000023080
Domain Number - Region: 616-704
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000916
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023080   Gene: ENSGACG00000017451   Transcript: ENSGACT00000023124
Sequence length 5971
Comment pep:novel group:BROADS1:groupIII:14057130:14092796:-1 gene:ENSGACG00000017451 transcript:ENSGACT00000023124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKNLFGGVPRFLTRPKAFSVCAGKDATLSCTIVGSPTPLVTWEKEKLKLTSGGRFKTVE
DGDVYRLTVYDLTLEDSGQFMCRARNSVGEAYAAVTLKVALPGEMAPRAPAFTVKPAPAR
VALGDDVVFHCRVVAHPEANFDWEKDGRYLGESNRIKIVSDSDGSILKIQSVRNLDGGTY
TCRAQNTVGRSHCAAALVVDAQDSRHLAADKNTSLLSHLQKRKEEMNKDISLASALAKLP
KGVFTRTCTVTEGKHAKLSCFVTGHPKPHITWRKDGANIREGRRQVIYEDHAENFILKIL
YCKQTDNGLYTCNATNMAGQTYSAVLVTVKEPKVPFRRKLQDVEVQEKASATLMCEVPVS
ATMSNWFMEETRLQQSTKYYMEQEGTLRRLTIHNVTTNDDGVYICEMKEGSRTVAELTVL
GNITKKLPRRTVVPVSDTVIFCVELEQPFPDAHWTRDGDKLQEDSRVSIACVLRQYTLTI
RDCQADDSGEVAFVAGDCKTSTRFSVTAARKHPPDPPVDAVVQNKTDSSVTIRWSPPDSE
RPVPIKGYIVEKRKIGTQTWQRCNAGETIVSTEVTVCSFTEEATYQFRISAMNDFGQSPH
LDVPGTFYLEPSAEIKKGLTSSVAHCGEEFSISVELSAVCSCFWSLGGRLLRSGADYLIT
RSKNTHTLLIRVVAMEMNGAEVKFVGGGSQSSCILTVKAPPVRFTNKSDVAEVVVCSAQA
TAQLTAEVSDYDAQVVWMRNEREVKMGKKYECLINERKRILTVHNVTEEDVGTYECVLAD
DRMPLRLALKDEPAKFLNKARGTVGMSSSLKGDLELSCEVSPASAAVAWRKDQVEITEDQ
RTTFVSKGTQRKLIIRNAKKTDEGHYSCETAADKVTFQVKIKETQAVAAFSNKESVQKEV
KASLSQKATLSCSVADSKTEVKWCKDGKSLISSRTIYSEMKGNTRQLVIEKVEKSDAGEY
TCEAGGDKLVFKIFVPEIQSAFSNKESVQKEVKATLSQKATLSCDVSDAKTEVKWWKDGK
LLATSKTIRTESTGRSRQLFIDSVEKKDAGEYVCEAGTEKMAFKIHVAEAQSAFSNKESV
QKEVKATLSQKATLSCDVSDAKTEVKWWKDGKLLATSKTIRTESKGRSRQLFIDSVEKKD
AGEYVCEAGTEKMAFKIHVAEAQSAFSNKESVQKEVKATLSQKATLSCEVADTKTEVKWW
KDGKLLATSKTIHTESRGKSRQLVLESVEKKDAGEYICDVGTEKMAFKIHVAEAQSAFSN
KESVQKEVKATLSQKATLSCEVADTKTEVKWWKDGKLLATSKTIHTESRGKSRQLVLESV
EKKDAGEYICDVGTEKLVFKLQVQAKSAFLSKDSVQKEVKATLSQKATLSCEVVDNKTEV
KWSKDGKLLSSSRAVHMESKGQTRQLVIDSVERKDAGEYACEVGTEKLAFKVQVTESQSK
SSFSNKESVQKEVKATLSQKATLSCDVADAKTEVKWWKDGKLLATSKTIRTESKGRSRQL
VIDSVEKKDAGEYVCEAGTEKMAFKIHVAEAQSAFSNKESVQKEVKATLSQKATLSCEVA
DTKTEVKWYKDGKLLTTSKTIRAESRGKSRQLVIDSVEKKDAGEYMCEAGPEKLTFKIQV
AESPAGFSNKESVRTEVKASLSQKATLSCEVSDSKTEVKWYKDGKLLTSSKAVHTESRGR
SCELVIEKMDKKDVGEYTCEAGTEKLVFKLQMADETVKFQKKLVKDTCTVQATEKVVLTT
ELTKECGNVKWFRDGVELKEGSKYEMKKEGLSRTLIVKSSESKDSGTYSCQTADDKLEFK
VQVKGKFSLKFVVPLKAATVELDGTLTLMCELDHASGDVVWQRDGREVKHGGRYCVRADG
AKRVLTVTGMTKEDEGEYSCECRNDRTSAKVSSKAPRLVRLTTKPNNVAAMEGKDAIFKC
AVNPADANVKWFHNSIPVTAGPKYKMERGGGSHSLTITSVTQKDAGEISVDAEGKNCKAS
LQVQHEPVTFKKKLENLTAEEQSEVRLAVELSKPSDEVRWMKNSVVLQSAANMEIRVDGA
KQALVFKSVTCADRGIYSCETLDDKTQAKLNVEMKKIEVLKGLTETKAHEAETVTLEVEL
SQADVEGSWTRDGAKFKTGASCRITALGKKHALTLSDLKREDAGTIAFQAEGVHSSSKLI
VTEPPAVISKPLTDISTPEKEKVTFDCEVSRTNADVKWFKGDVEVKPGKNVGIHSLGRKR
TLVINKCAPEDAGTYICRTADDNTAATLAVQGKTYTLLFKAVTTEDMGEIKFTADKASST
AKLRVKELPVKFVKRLRDKIAMFKHRGHLECQVSRASATVKWYKNKLEIKHGKKYEIKAE
DVYRKLIINDVDSGDEDTYTCDGADDKTSCKLLVEEQSISIVRELSSVEVTEPFAAVFEV
EISMELVKPPIWTLNGVPVQESADVEMEKEGTMHRLTFKKTKASMSGPVQFTAGKSKSLA
QLAVKERPLEIAEPIKDVKAKEKSSAILTCKFSAAPKEVNWFRGQVPLSASDKYNIKGDA
TRAQLTIQRLTEEDSGEYRCQSGPAETRGTLTVEVRDIKITKHLADTEVDEDNDAVFTCE
INYADEEVQWLLNDKVLFTNEVNAIAHDGKVHRLTLKNLAPQDGGTIAFKVRKVKESVTL
QVKEKRAVFLKSLDDVIGEEKGMITLACEASKPRVSPTWRKEGQVLKAGSKYELLHTGRS
LGLIIKDVTKEDAGEYSCDLGTEVSKAKVTVRELGIGITKWLKSAEVNEGDSCSFECILS
RESTDECSWTLNGHTVTNGGRFNVTSKGRKYMLTVKDVVPADAGEVVFNIKDLSSKTTLT
IFYSIKMKMSGSPFAGRAAYVSKELQNVSAVQGEDAVFTCELTQSNSTVKWAKESKAIKK
SQKYDICQEEKILKLTVRNVSAQDSGEYSCEVVGGATTKAKLEIREPIHKFTKALMDSRA
EEKSSLTLQCQTAQTASAVTWLKGHAELTAGGRYEMSQKGEILTLTIKHLEVEDTDIYTC
DVGTAKSMAKVTVDGKYRASGCAVFWIKRAVVGKPSSKGTPAQPLDDWNTTTHASFFPFN
HFPPCMTSNTPTKAPCFLQSHSILAPPANFKEKLNNQEKKEGESVTLCCKLSKPANCVQW
KKGSEILKSGGKYDMKQEETSCELQIKNLEVEDSGEYYCTCGDQKTSATVKVNALPPNYV
QKLESQEAEEGASVTLRCELSKPGVPVEWKKGTETLKSGEMYQMKQKACVNELLINKVEP
EDSGDYSCVCGDQKTSASIKINVLPVTVVRDLESQEAEEGNIVTLHCELSKPRLPVQWKR
GTQVLSCGEKYHMKQMGFTYELQIFDVRLEDTGSYACCSEETLCSASVVVNAAPVIFIKE
LESQMADEGGSVTLHCELSKPGVPLEWRKGELGLCPCAKYEIRQSAHQASLVIHDVDRED
AGSYTCDTGVHRSSAQVDVKGMLAKTIERLQNLEREEGEGASLRCETTKPGASVVWRCGD
RTLAPSSKYHLRQEGTTVELFIYRLQTADSGEYSCDTGYQRTSAVLTVQEVEVSILKFLE
SCVVYEGEDVRFECRVSREDAPLAQWKLQDVPLQSNEMNLIRSEGLVHSLTLRGVTAADS
GTVTFTVGNHTSTASLTVRAAPVVFTKELESQKAVEGDEATLSCETSSPDCRVIWTKGSS
VLTAGEKFSMEQRAATHSLLIRKLNAKDSGEYTCDTGEKKTTATLTVKEHVRLVRELRDM
TVATGQDAVFEVELSHSDVTNGEWWLGENLLQNNDLNQMSCQGKVHRLVLKMVTTDESGD
VAFVVGQEKSVACLLVEEKPKVLILEKPLDTVALEGEMVTLACTVSDAKATVTWIRNKVA
IRAGLKYDLRSNGALHQLCIHNPVPEDSGTYTCDTGDAQCDVSLTVEGAPVFFHKELKNL
DAVEGDDVTLRCELSKPGVRVEWRKGGIVLQPGMKCEMRQEGCIQELLLRNLEPEDSGYY
TCDAGDQLTTSSLAVQGSLFQYCFYLSSPFLKADFVCICVSFHPTVKEVFIVCGLKTVDV
FVGEWATFSCQLSGRAPGQVQWWLDGTLLENSAFSEIELSQGHIHTLTLKDLATDDSGAV
TFKAGNLTSTAKLLVKDPTVEVVSEMEDLRVLENQPAEFVCQYSRPVKAQWKKDGRPLQP
DGRRVLVEEDWNVARLYISRVSAEDRGTYSCEAGETCSVASLYVEGKPIDIVQGLENVET
FDGGEALFECALSRPESKDCHWLLDGKPVKESPNAEIVTFESGLRHLLLLKELRVKDSCT
VTFKACAASSSAQLCVKRWQLDVVKPLEDKVAAVGEKVEFCVELTEPVPMAEVAWYANGV
EIKPSDLWATRADGCSYRLVLRRAPLLPPQEITFAARDALSLAKLNIITVPDPPEDPEVL
NKTEKSVVLSWFTPLHDGGSPILGYRVEMRLADSSLWLPSHSEPVCNTEFVVENLTPGSG
YRFRVAAINRAGIGEPVELPQTVQLGEWHKVDFSIGTKDGGTLLSYVILFDTEHLIVVIG
TKAKQEESEMMGQPSLPPEAAEEGDVHELWEESAKKRRMSREPTLDSITEQPEEVVGGQK
KSAQKDLKSVEKVEIKSEEQAQVTVSKKQTESKVSSSSGDVSVAGGSTLVSYLKKSSTAS
VTATSETVQHTSVETTTIQQTDGQQVPAKEADSMEISKEDEPELRDAAIKIQAAFKGYKA
RRDMRPVFKDGFKDQTKEPNGTIHLECVAEGKPDKMRWLKDGEPLQDGKHHHIDIYNDGT
CSLVITAITTKDTGVYSCEVTNRFGVTSHSGKVTVGTERETEPESSSGSEMDDSLRQASR
RLRRLLRTRLPPDVEEEPFVSADEGDLGHPDPHSYREDDSYIYIRFDSRTEAEVASKRFM
EMFTVHGVPVETTILEAGPLKVELRIRKMGYTQDGTQTPTQERQPPAFMAGAQAAPVFLT
ELQSQDVPDGYPVSFDCVVIGKPTPAVRWYKDGKLLAENDHYMINEDQEGCHQLIITAVL
PTDMGVYRCTAENSSGIAATKAELRVDMSCSSDYDTAADATETSSYVSARGYMSRETETF
ESVAEDDQLPQVVDELHDVHVSPGSPVAKMQLKVKGFPKPRIYWFKDGHPLRSSGRILLL
AERDVHAVEILEVKKEDMGEYSAYISNAAGSAYSSARLVVLSIDSFPDPKVPLVPPRFLE
RFSNRKVKQGASITLSVKVEGSPAPMVSWLKEESVEDVLWIKPDTKGYKIASSGRQHSLI
LMDVGTEYTGAYTCIATNRAGQSICTAHLGVDQTPQPKKEPKASESVTFTLLRVLNITVS
APEEAAGKAKGEILFCESKTSYLGEVGTEEFLLKLTNQITEMVSAKITQASLRVPGADSD
DETKTPSASPHHGRSRPPSLIADSSSESDEGDARGEMCDIYVATADYNPTLASKESISLK
EGQYVEVLDSAHPLKWLVRTKPTKNTPSRQGWVSPAYLDKKLKLSADSSDLPETNSEEVS
EGEYKRKLFQLIQELINGESEFVKEMDFFTSHHRKHADSPDAPPDVSSQTEAIFRNIDDI
NSFHSKAFLPKLNDCDTDDDVAMCFLKNKEGFEKYLHYLVGQSLAESAVSDKAVHRFFKE
YTDKVQANADPADPPVRSVNASLQQPLERIQKYKAALKELIRNKAKNGQNCCLLEEAYAM
VSALPQRSENTHHVSMIENYPATLDVLGEPMRQGPFQVWEGAPGIRTSSRGHHRHVFLFK
NYCIICKPKRDSNTDTQQYVFKNMMKLNNIDVNETVEGDDRAFEIWHEREDSVRKYTLQA
RTVTIKNSWLRDFRELQQRYSMPAWSPPDFDEILANCTAELGQTVKLACKVTGVPKPAVT
WFKDGRAVEADPHHIVIQDPDGSCTLILDNMTADDSGQYMCFAASSAGNASTLGKITVQV
PPRFVNKMRNATFVAGGDTQFTCVIQSAPNPKIRWFKDGRLLTDQEKYQTYSELRSGVLV
LAIKNLTERDLGHYECELSNRLGTAKCGARL
Download sequence
Identical sequences G3PZP0
ENSGACP00000023080 69293.ENSGACP00000023080 ENSGACP00000023080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]